F210898

General Info

Members Datasets Scaffolds Average Seq Length
151 118 302 205

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100004720|Ga0070663_1000047205
Length 239
Sequence MKTNVEKTRGRPLSFDREQALENAMHVFWDRGYEAASIAELTAAMGITAPSLYSAFGDKEHLFLEAIERYANGAGSAAPRALAEELTARAAIERLLCEAAKELTRSCHPAGCMVVMAATNCSVASAHIQTALAKRRAASEEGIRTRIEQGIVDGELPADTDAAALANFYTTVFQGMSIQARDGASRASLLATAATAMRAWPVQLSVEDCISKRSGQHLTRFQDRIKCNQPGGQDGIKCN

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
64 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
65 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
71 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
72 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
106 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
107 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
108 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
109 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
110 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
111 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
112 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
113 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
114 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
115 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
116 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
117 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
118 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 0
Isolates 9.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.89
Nodule 1.99
Rhizoplane 1.99
Rhizosphere 54.3
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100004720 3300005455 Bacteria 8039
2 JGI24735J21928_10029627 3300002067 Bacteria 1629
3 JGI25151J46595_10000370 3300003187 Bacteria 47135
4 rootH1_10014856 3300003316 Bacteria 1465
5 rootH2_10000999 3300003320 Bacteria 2445
6 rootH1_10023292 3300003323 Bacteria 2995
7 JGI25160J50197_1008203 3300003354 Bacteria 4000
8 JGI25407J50210_10015492 3300003373 Bacteria 1969
9 Ga0055525_1000004 3300003759 Bacteria 888039
10 Ga0055540_1011609 3300003792 Bacteria 2825
11 Ga0070667_100160565 3300005367 Bacteria 1979
12 Ga0068853_100202210 3300005539 Bacteria 1808
13 Ga0068855_100037752 3300005563 Bacteria 5742
14 Ga0068855_100378607 3300005563 Bacteria 1554
15 Ga0068852_100275620 3300005616 Bacteria 1620
16 Ga0081455_10004495 3300005937 Bacteria 15600
17 Ga0081538_10015233 3300005981 Bacteria 5965
18 Ga0081538_10041823 3300005981 Bacteria 2902
19 Ga0081540_1014772 3300005983 Bacteria 4979
20 Ga0081540_1035963 3300005983 Bacteria 2648
21 Ga0075363_100113899 3300006048 Bacteria 1505
22 Ga0075364_10069321 3300006051 Bacteria 2320
23 Ga0075364_10121297 3300006051 Bacteria 1750
24 Ga0075362_10297384 3300006177 Bacteria 801
25 Ga0075369_10002664 3300006186 Bacteria 6391
26 Ga0075370_10003614 3300006353 Bacteria 7398
27 Ga0075370_10339253 3300006353 Bacteria 897
28 Ga0105240_10010631 3300009093 Bacteria 12927
29 Ga0105240_10194133 3300009093 Bacteria 2385
30 Ga0105237_10278094 3300009545 Bacteria 1676
31 Ga0105238_10327931 3300009551 Bacteria 1517
32 Ga0105239_10324687 3300010375 Bacteria 1736
33 Ga0157369_10002189 3300013105 Bacteria 23542
34 Ga0213872_10000011 3300021361 Bacteria 194139
35 Ga0213872_10001207 3300021361 Bacteria 17517
36 Ga0213872_10003861 3300021361 Bacteria 8141
37 Ga0209563_100013 3300025230 Bacteria 941463
38 Ga0209130_1000543 3300025284 Bacteria 37920
39 Ga0209025_1000061 3300025294 Bacteria 304827
40 Ga0209758_1003384 3300025297 Bacteria 14594
41 Ga0209256_1030919 3300025299 Bacteria 1471
42 Ga0207426_1000092 3300025302 Bacteria 278907
43 Ga0209051_1008228 3300025303 Bacteria 5555
44 Ga0207695_10161423 3300025913 Bacteria 2172
45 Ga0207671_10314030 3300025914 Bacteria 1239
46 Ga0207700_10957555 3300025928 Bacteria 766
47 Ga0207667_10019629 3300025949 Bacteria 7537
48 Ga0207658_10063030 3300025986 Bacteria 2777
49 Ga0207639_10285097 3300026041 Bacteria 1454
50 Ga0207678_10010850 3300026067 Bacteria 8007
51 Ga0268266_10641205 3300028379 Bacteria 1022
52 Ga0268264_10885398 3300028381 Bacteria 895
53 Ga0307515_10003339 3300028794 Bacteria 33908
54 Ga0307515_10035742 3300028794 Bacteria 8067
55 Ga0307515_10230756 3300028794 Bacteria 1644
56 Ga0265331_10002087 3300031250 Bacteria 13819
57 Ga0265327_10000028 3300031251 Bacteria 361066
58 Ga0307513_10269889 3300031456 Bacteria 1485
59 Ga0307509_10154796 3300031507 Bacteria 2200
60 Ga0307509_10294110 3300031507 Bacteria 1376
61 Ga0307408_100230094 3300031548 Bacteria 1518
62 Ga0307508_10000053 3300031616 Bacteria 128020
63 Ga0307508_10000273 3300031616 Bacteria 63550
64 Ga0307514_10060120 3300031649 Bacteria 2900
65 Ga0307516_10416433 3300031730 Bacteria 1002
66 Ga0307405_10165149 3300031731 Bacteria 1573
67 Ga0307410_10024074 3300031852 Bacteria 3798
68 Ga0307410_10454027 3300031852 Bacteria 1046
69 Ga0307409_100825591 3300031995 Bacteria 936
70 Ga0307416_100274847 3300032002 Bacteria 1657
71 Ga0307416_100866541 3300032002 Bacteria 1002
72 Ga0307416_101616543 3300032002 Bacteria 753
73 Ga0307414_10089948 3300032004 Bacteria 2277
74 Ga0307414_10348012 3300032004 Bacteria 1271
75 Ga0307507_10093588 3300033179 Bacteria 2559
76 Ga0307510_10113652 3300033180 Bacteria 2440
77 Ga0395905_0313392 3300037471 Bacteria 1457
78 Ga0436365_0549816 3300039437 Bacteria 664
79 Ga0436361_0296121 3300039447 Bacteria 160237
80 Ga0436361_0490308 3300039447 Bacteria 9571
81 Ga0436361_0587342 3300039447 Bacteria 6405
82 Ga0451837_0717886 3300041494 Bacteria 608
83 Ga0439431_0069958 3300041997 Bacteria 934
84 Ga0495627_001339 3300046453 Bacteria 14899
85 Ga0495607_0000003 3300046501 Bacteria 366900
86 Ga0495606_0001435 3300046507 Bacteria 31977
87 Ga0495637_0008730 3300046520 Bacteria 4967
88 Ga0495649_0216669 3300046694 Bacteria 991
89 Ga0495636_0086250 3300047318 Bacteria 1358
90 Ga0495673_0000182 3300047469 Bacteria 101303
91 Ga0495686_0002895 3300047472 Bacteria 15412
92 Ga0495686_0097694 3300047472 Bacteria 1775
93 Ga0495626_0148904 3300048091 Bacteria 988
94 Ga0496102_0000079 3300048905 Bacteria 140942
95 Ga0496103_0000357 3300048906 Bacteria 41370
96 Ga0496116_0259253 3300048919 Unclassified 859
97 Ga0496117_0046913 3300048920 Bacteria 3104
98 Ga0496118_0009856 3300048921 Bacteria 9557
99 Ga0496118_0014887 3300048921 Bacteria 7246
100 Ga0496121_0000264 3300048924 Bacteria 109400
101 Ga0496121_0023932 3300048924 Bacteria 5857
102 Ga0496121_0061692 3300048924 Bacteria 3075
103 Ga0496121_0215178 3300048924 Bacteria 1358
104 Ga0496122_0035016 3300048925 Bacteria 4097
105 Ga0496122_0053455 3300048925 Bacteria 3044
106 Ga0496123_0034212 3300048926 Bacteria 3644
107 Ga0496123_0034733 3300048926 Bacteria 3606
108 Ga0496124_0000038 3300048927 Bacteria 312485
109 Ga0496124_0004137 3300048927 Bacteria 17138
110 Ga0496126_0018156 3300048929 Bacteria 6979
111 Ga0501032_0437501 3300049569 Bacteria 838
112 Ga0501033_0128101 3300049570 Bacteria 1840
113 Ga0501034_0100124 3300049571 Bacteria 2892
114 Ga0501034_0177308 3300049571 Bacteria 2097
115 Ga0501037_0060101 3300049573 Bacteria 2772
116 Ga0501038_0153843 3300049574 Bacteria 1874
117 Ga0501038_0238466 3300049574 Bacteria 1445
118 Ga0501039_0054998 3300049575 Bacteria 3082
119 Ga0501047_0258767 3300049581 Bacteria 1588
120 Ga0501047_0752453 3300049581 Bacteria 790
121 Ga0501068_0257918 3300049584 Bacteria 1112
122 Ga0501070_0185920 3300049586 Bacteria 1709
123 Ga0501073_0060771 3300049589 Bacteria 2637
124 Ga0501073_0105261 3300049589 Bacteria 1958
125 Ga0501073_0118871 3300049589 Bacteria 1832
126 Ga0501080_0048133 3300049742 Bacteria 3969
127 Ga0501083_0006258 3300049744 Bacteria 8448
128 Ga0501083_0196400 3300049744 Bacteria 1316
129 Ga0501035_0442760 3300049822 Bacteria 1076
130 Ga0501044_0103984 3300049823 Bacteria 2854
131 nmdc:mga03n38_287059_c1 3300050490 Bacteria 880
132 nmdc:mga00v17_198513_c1 3300050491 Bacteria 1296
133 nmdc:mga00v17_276503_c1 3300050491 Bacteria 1090
134 nmdc:mga07m45_58750_c1 3300050496 Bacteria 2176
135 nmdc:mga0sz30_111892_c1 3300050516 Bacteria 1197
136 Ga0500622_0000551 3300053156 Bacteria 34376
137 Ga0501082_0045653 3300060353 Bacteria 3778
138 2511123052 2510917020 Bacteria 5657507
139 2524468296 2524023210 Bacteria 9029266
140 2595452968 2593339239 Bacteria 4124669
141 2599724357 2599185236 Bacteria 6875203
142 2821449970 2821443989 Bacteria 7658172
143 2844537210 2844533157 Bacteria 7517899
144 2857544716 2857542790 Bacteria 5326616
145 2883359992 2883354860 Bacteria 5865246
146 2884816226 2884811622 Bacteria 5552861
147 2884840940 2884836552 Bacteria 5219991
148 2884857464 2884852848 Bacteria 5221161
149 2894239573 2894232714 Bacteria 8834183
150 2896158404 2896154374 Bacteria 5221518
151 8056211695 8056207758 Bacteria 8639239
152 Ga0070663_100004720
153 JGI24735J21928_10029627
154 JGI25151J46595_10000370
155 rootH1_10014856
156 rootH2_10000999
157 rootH1_10023292
158 JGI25160J50197_1008203
159 JGI25407J50210_10015492
160 Ga0055525_1000004
161 Ga0055540_1011609
162 Ga0070667_100160565
163 Ga0068853_100202210
164 Ga0068855_100037752
165 Ga0068855_100378607
166 Ga0068852_100275620
167 Ga0081455_10004495
168 Ga0081538_10015233
169 Ga0081538_10041823
170 Ga0081540_1014772
171 Ga0081540_1035963
172 Ga0075363_100113899
173 Ga0075364_10069321
174 Ga0075364_10121297
175 Ga0075362_10297384
176 Ga0075369_10002664
177 Ga0075370_10003614
178 Ga0075370_10339253
179 Ga0105240_10010631
180 Ga0105240_10194133
181 Ga0105237_10278094
182 Ga0105238_10327931
183 Ga0105239_10324687
184 Ga0157369_10002189
185 Ga0213872_10000011
186 Ga0213872_10001207
187 Ga0213872_10003861
188 Ga0209563_100013
189 Ga0209130_1000543
190 Ga0209025_1000061
191 Ga0209758_1003384
192 Ga0209256_1030919
193 Ga0207426_1000092
194 Ga0209051_1008228
195 Ga0207695_10161423
196 Ga0207671_10314030
197 Ga0207700_10957555
198 Ga0207667_10019629
199 Ga0207658_10063030
200 Ga0207639_10285097
201 Ga0207678_10010850
202 Ga0268266_10641205
203 Ga0268264_10885398
204 Ga0307515_10003339
205 Ga0307515_10035742
206 Ga0307515_10230756
207 Ga0265331_10002087
208 Ga0265327_10000028
209 Ga0307513_10269889
210 Ga0307509_10154796
211 Ga0307509_10294110
212 Ga0307408_100230094
213 Ga0307508_10000053
214 Ga0307508_10000273
215 Ga0307514_10060120
216 Ga0307516_10416433
217 Ga0307405_10165149
218 Ga0307410_10024074
219 Ga0307410_10454027
220 Ga0307409_100825591
221 Ga0307416_100274847
222 Ga0307416_100866541
223 Ga0307416_101616543
224 Ga0307414_10089948
225 Ga0307414_10348012
226 Ga0307507_10093588
227 Ga0307510_10113652
228 Ga0395905_0313392
229 Ga0436365_0549816
230 Ga0436361_0296121
231 Ga0436361_0490308
232 Ga0436361_0587342
233 Ga0451837_0717886
234 Ga0439431_0069958
235 Ga0495627_001339
236 Ga0495607_0000003
237 Ga0495606_0001435
238 Ga0495637_0008730
239 Ga0495649_0216669
240 Ga0495636_0086250
241 Ga0495673_0000182
242 Ga0495686_0002895
243 Ga0495686_0097694
244 Ga0495626_0148904
245 Ga0496102_0000079
246 Ga0496103_0000357
247 Ga0496116_0259253
248 Ga0496117_0046913
249 Ga0496118_0009856
250 Ga0496118_0014887
251 Ga0496121_0000264
252 Ga0496121_0023932
253 Ga0496121_0061692
254 Ga0496121_0215178
255 Ga0496122_0035016
256 Ga0496122_0053455
257 Ga0496123_0034212
258 Ga0496123_0034733
259 Ga0496124_0000038
260 Ga0496124_0004137
261 Ga0496126_0018156
262 Ga0501032_0437501
263 Ga0501033_0128101
264 Ga0501034_0100124
265 Ga0501034_0177308
266 Ga0501037_0060101
267 Ga0501038_0153843
268 Ga0501038_0238466
269 Ga0501039_0054998
270 Ga0501047_0258767
271 Ga0501047_0752453
272 Ga0501068_0257918
273 Ga0501070_0185920
274 Ga0501073_0060771
275 Ga0501073_0105261
276 Ga0501073_0118871
277 Ga0501080_0048133
278 Ga0501083_0006258
279 Ga0501083_0196400
280 Ga0501035_0442760
281 Ga0501044_0103984
282 nmdc:mga03n38_287059_c1
283 nmdc:mga00v17_198513_c1
284 nmdc:mga00v17_276503_c1
285 nmdc:mga07m45_58750_c1
286 nmdc:mga0sz30_111892_c1
287 Ga0500622_0000551
288 Ga0501082_0045653
289 2511123052
290 2524468296
291 2595452968
292 2599724357
293 2821449970
294 2844537210
295 2857544716
296 2883359992
297 2884816226
298 2884840940
299 2884857464
300 2894239573
301 2896158404
302 8056211695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

20

66

0.97

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

91

199

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.9329 5 195
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.9323 4 195
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.9283 5 195
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.9277 4 195
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.8576 11 192
ID Description Score Start End Superfamily
2i10B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.97 14 64 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9425 11 59 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9416 13 59 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9409 11 59 1.10.10.60
2np3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.936 11 60 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q7L908-F1-model_v4 TetR family transcriptional regulator 0.9791 20 197 GO:0003677
GO:0006355
AF-A0A2P8EFM1-F1-model_v4 TetR family transcriptional regulator 0.9784 40 192 GO:0003677
GO:0006355
AF-A0A7W7ZR47-F1-model_v4 AcrR family transcriptional regulator 0.9783 20 191 GO:0003677
GO:0006355
AF-A0A4P2R680-F1-model_v4 Tetracyclin repressor-like C-terminal domain-containing protein 0.9779 40 199 GO:0003677
GO:0006355
AF-A0A495JC59-F1-model_v4 TetR family transcriptional regulator 0.9773 17 199 GO:0003677
GO:0006355

Map