F211701

General Info

Members Datasets Scaffolds Average Seq Length
151 116 149 312

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10000004|Ga0207692_10000004377
Length 362
Sequence LLGIVRNQGFVGERRTHQRNGLSGAGTGARRPLHVNEALGDRHSMRSAFAHTLLELAETDERIVLLTGDLGFAVLEPFAERHPERFWNVGVAEQNMVGVATGLADAGYTPYVYSIATFASMRGYEFVRNGPILHELPVRVVGVGGGMDYGHNGVTHYALEDAGIMRVQPGIAVIAPADPEQTRAALPAIQGLPGPVYLRLGKESQPVPGLDGRFALGRAERIGGGRDVALVTLGGMAATAVEAAERLAADGVDASVLVVSSLNPAPTDDLAEALADVPVALSAEAHYVNGALGSLVAETIAEQGLACRLVRAGLRAMPIGATGSRPHLYERHGLAPDQLAASALRALEGVPAPVTTGATQPR

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 13.91
Rhizosphere 83.44
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100210133 3300005330 Bacteria 1358
2 Ga0070660_100069962 3300005339 Bacteria 2738
3 Ga0070660_100099251 3300005339 Unclassified 2305
4 Ga0070692_10011181 3300005345 Bacteria 4115
5 Ga0070669_100015020 3300005353 Bacteria 5521
6 Ga0070675_100131589 3300005354 Unclassified 2132
7 Ga0070675_100255000 3300005354 Bacteria 1536
8 Ga0070671_100193678 3300005355 Bacteria 1723
9 Ga0070674_100000158 3300005356 Bacteria 31265
10 Ga0070688_100120624 3300005365 Unclassified 1756
11 Ga0070659_100000003 3300005366 Bacteria 309142
12 Ga0070667_100126873 3300005367 Bacteria 2224
13 Ga0070714_100000026 3300005435 Bacteria 145396
14 Ga0070714_100002361 3300005435 Bacteria 13885
15 Ga0070714_100008290 3300005435 Bacteria 8106
16 Ga0070714_100044277 3300005435 Unclassified 3767
17 Ga0070710_10000001 3300005437 Bacteria 552187
18 Ga0070705_100016817 3300005440 Bacteria 3808
19 Ga0070663_100028484 3300005455 Bacteria 3804
20 Ga0070678_100005721 3300005456 Bacteria 7221
21 Ga0070681_10030037 3300005458 Bacteria 5453
22 Ga0070707_100022723 3300005468 Bacteria 5930
23 Ga0070707_100130533 3300005468 Unclassified 2443
24 Ga0070707_100142425 3300005468 Bacteria 2333
25 Ga0070699_100051081 3300005518 Unclassified 3580
26 Ga0070679_100037418 3300005530 Bacteria 4820
27 Ga0070684_100047368 3300005535 Bacteria 3725
28 Ga0070686_100017604 3300005544 Bacteria 4178
29 Ga0070704_100033431 3300005549 Bacteria 3477
30 Ga0068852_100085100 3300005616 Bacteria 2816
31 Ga0068863_100461626 3300005841 Bacteria 1247
32 Ga0068858_100018296 3300005842 Bacteria 6561
33 Ga0068860_100003145 3300005843 Bacteria 17056
34 Ga0081539_10000615 3300005985 Bacteria 72134
35 Ga0070712_100000061 3300006175 Bacteria 54506
36 Ga0097621_100080148 3300006237 Bacteria 2715
37 Ga0075431_100255161 3300006847 Unclassified 1781
38 Ga0075429_100066666 3300006880 Bacteria 3134
39 Ga0075429_100129836 3300006880 Unclassified 2204
40 Ga0068865_100201588 3300006881 Bacteria 1545
41 Ga0075435_100433703 3300007076 Bacteria 1132
42 Ga0111539_10092692 3300009094 Bacteria 3550
43 Ga0105245_10695232 3300009098 Bacteria 1050
44 Ga0105247_10060788 3300009101 Bacteria 2342
45 Ga0105247_10096864 3300009101 Bacteria 1881
46 Ga0114129_10005255 3300009147 Bacteria 18253
47 Ga0114129_10056745 3300009147 Bacteria 5483
48 Ga0105243_10001387 3300009148 Bacteria 21471
49 Ga0105242_10005685 3300009176 Bacteria 9624
50 Ga0105248_10416764 3300009177 Bacteria 1512
51 Ga0105238_10400079 3300009551 Bacteria 1366
52 Ga0105249_10158058 3300009553 Bacteria 2188
53 Ga0105246_10002227 3300011119 Bacteria 11700
54 Ga0157378_10005390 3300013297 Bacteria 11215
55 Ga0157375_10088265 3300013308 Bacteria 3155
56 Ga0163163_10256593 3300014325 Bacteria 1799
57 Ga0157379_10001684 3300014968 Bacteria 18272
58 Ga0157379_10042022 3300014968 Bacteria 4080
59 Ga0157376_10021276 3300014969 Bacteria 5037
60 Ga0207692_10000004 3300025898 Bacteria 413600
61 Ga0207642_10005941 3300025899 Bacteria 4023
62 Ga0207710_10034227 3300025900 Bacteria 2231
63 Ga0207710_10056466 3300025900 Bacteria 1771
64 Ga0207684_10010615 3300025910 Bacteria 8096
65 Ga0207707_10026098 3300025912 Bacteria 5108
66 Ga0207693_10000201 3300025915 Bacteria 54465
67 Ga0207660_10052428 3300025917 Bacteria 2904
68 Ga0207662_10039712 3300025918 Unclassified 2762
69 Ga0207657_10078658 3300025919 Bacteria 2776
70 Ga0207646_10060865 3300025922 Unclassified 3371
71 Ga0207646_10112044 3300025922 Unclassified 2449
72 Ga0207646_10301394 3300025922 Bacteria 1448
73 Ga0207681_10010983 3300025923 Bacteria 5562
74 Ga0207659_10094666 3300025926 Bacteria 2239
75 Ga0207664_10000012 3300025929 Bacteria 278872
76 Ga0207664_10000498 3300025929 Bacteria 27964
77 Ga0207690_10000306 3300025932 Bacteria 33820
78 Ga0207686_10043194 3300025934 Bacteria 2761
79 Ga0207669_10000083 3300025937 Bacteria 47557
80 Ga0207669_10061240 3300025937 Bacteria 2312
81 Ga0207704_10032328 3300025938 Bacteria 2960
82 Ga0207661_10021447 3300025944 Bacteria 4839
83 Ga0207661_10102928 3300025944 Bacteria 2402
84 Ga0207651_10289314 3300025960 Bacteria 1358
85 Ga0207712_10122832 3300025961 Bacteria 1967
86 Ga0207658_10116645 3300025986 Bacteria 2121
87 Ga0207703_10138283 3300026035 Bacteria 2111
88 Ga0207678_10024548 3300026067 Bacteria 5266
89 Ga0207683_10000068 3300026121 Bacteria 78969
90 Ga0265326_10000094 3300028558 Bacteria 45864
91 Ga0265326_10045257 3300028558 Bacteria 1248
92 Ga0265319_1000227 3300028563 Bacteria 42176
93 Ga0265319_1002185 3300028563 Bacteria 10896
94 Ga0265319_1032859 3300028563 Bacteria 1796
95 Ga0265334_10000134 3300028573 Bacteria 46634
96 Ga0265318_10094075 3300028577 Bacteria 1103
97 Ga0265336_10038799 3300028666 Bacteria 1461
98 Ga0265338_10000383 3300028800 Bacteria 79248
99 Ga0265338_10010647 3300028800 Bacteria 10749
100 Ga0265338_10045765 3300028800 Bacteria 4019
101 Ga0265324_10003744 3300029957 Bacteria 7114
102 Ga0265324_10004756 3300029957 Bacteria 6015
103 Ga0265320_10043112 3300031240 Bacteria 2233
104 Ga0265325_10028518 3300031241 Bacteria 3009
105 Ga0307411_10364374 3300032005 Bacteria 1183
106 Ga0373927_0001014 3300035695 Bacteria 21403
107 Ga0373925_0000660 3300037068 Bacteria 32393
108 Ga0395899_0018823 3300037312 Bacteria 5247
109 Ga0395900_0043806 3300037418 Bacteria 4612
110 Ga0395898_0175765 3300037466 Bacteria 2046
111 Ga0395905_0487599 3300037471 Unclassified 1132
112 Ga0395901_0049629 3300038443 Bacteria 4360
113 Ga0400489_09071 3300039093 Bacteria 54909
114 Ga0453684_0020990 3300044712 Bacteria 9794
115 Ga0495605_0042167 3300046474 Unclassified 2270
116 Ga0495639_0089091 3300046475 Bacteria 1445
117 Ga0495630_0000423 3300046517 Bacteria 32391
118 Ga0495625_0000154 3300046660 Bacteria 105083
119 Ga0495657_0000021 3300046675 Bacteria 153590
120 Ga0496100_0000254 3300048903 Bacteria 27391
121 Ga0496100_0009189 3300048903 Bacteria 5546
122 Ga0496101_0002622 3300048904 Bacteria 11056
123 Ga0496101_0002731 3300048904 Bacteria 10832
124 Ga0496102_0047677 3300048905 Bacteria 3895
125 Ga0496102_0197335 3300048905 Bacteria 1897
126 Ga0496104_0011692 3300048907 Bacteria 7871
127 Ga0496104_0443418 3300048907 Bacteria 1210
128 Ga0496105_0110292 3300048908 Bacteria 2271
129 Ga0496106_0005829 3300048909 Bacteria 9110
130 Ga0496106_0289534 3300048909 Bacteria 1313
131 Ga0496107_0005567 3300048910 Bacteria 8626
132 Ga0496109_0001480 3300048912 Bacteria 19498
133 Ga0496109_0008122 3300048912 Bacteria 8899
134 Ga0496112_0001307 3300048915 Bacteria 18926
135 Ga0496112_0301111 3300048915 Bacteria 1549
136 Ga0496113_0185746 3300048916 Bacteria 1649
137 Ga0496114_0004670 3300048917 Bacteria 10647
138 Ga0496114_0025086 3300048917 Bacteria 4870
139 Ga0496115_0000004 3300048918 Bacteria 319734
140 Ga0496115_0083570 3300048918 Bacteria 2603
141 Ga0496117_0001638 3300048920 Bacteria 31520
142 Ga0501069_0044823 3300049585 Bacteria 2449
143 Ga0501070_0000124 3300049586 Bacteria 68928
144 Ga0501080_0003636 3300049742 Bacteria 13601
145 nmdc:mga0yw44_94344_c1 3300050492 Unclassified 1335
146 nmdc:mga09592_12283_c1 3300050508 Bacteria 6972
147 nmdc:mga09592_212107_c1 3300050508 Unclassified 1678
148 nmdc:mga08y16_135137_c1 3300050511 Bacteria 2563
149 Ga0500595_026098 3300053119 Bacteria 2017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100044277 Ga0070714_1000442772 278
2 3300028563 Ga0265319_1032859 Ga0265319_10328592 283
3 3300009147 Ga0114129_10056745 Ga0114129_100567454 288
4 3300005345 Ga0070692_10011181 Ga0070692_100111813 295
5 3300048916 Ga0496113_0185746 Ga0496113_0185746_134_1141 295
6 3300005518 Ga0070699_100051081 Ga0070699_1000510813 302
7 3300005842 Ga0068858_100018296 Ga0068858_1000182965 302
8 3300044712 Ga0453684_0020990 Ga0453684_0020990_8846_9766 303
9 3300005841 Ga0068863_100461626 Ga0068863_1004616261 305
10 3300005985 Ga0081539_10000615 Ga0081539_1000061538 305
11 3300007076 Ga0075435_100433703 Ga0075435_1004337032 305
12 3300009101 Ga0105247_10060788 Ga0105247_100607883 305
13 3300014325 Ga0163163_10256593 Ga0163163_102565932 305
14 3300014968 Ga0157379_10042022 Ga0157379_100420222 305
15 3300014969 Ga0157376_10021276 Ga0157376_100212762 305
16 3300025900 Ga0207710_10034227 Ga0207710_100342273 305
17 3300028558 Ga0265326_10045257 Ga0265326_100452571 305
18 3300028563 Ga0265319_1000227 Ga0265319_100022710 305
19 3300028666 Ga0265336_10038799 Ga0265336_100387992 305
20 3300028800 Ga0265338_10000383 Ga0265338_1000038342 305
21 3300031241 Ga0265325_10028518 Ga0265325_100285182 305
22 3300035695 Ga0373927_0001014 Ga0373927_0001014_5224_6141 305
23 3300037068 Ga0373925_0000660 Ga0373925_0000660_6115_7032 305
24 3300037312 Ga0395899_0018823 Ga0395899_0018823_1524_2453 305
25 3300037418 Ga0395900_0043806 Ga0395900_0043806_2708_3637 305
26 3300037466 Ga0395898_0175765 Ga0395898_0175765_416_1345 305
27 3300037471 Ga0395905_0487599 Ga0395905_0487599_76_1005 305
28 3300038443 Ga0395901_0049629 Ga0395901_0049629_2447_3376 305
29 3300046475 Ga0495639_0089091 Ga0495639_0089091_255_1178 305
30 3300046517 Ga0495630_0000423 Ga0495630_0000423_30048_30968 305
31 3300046660 Ga0495625_0000154 Ga0495625_0000154_46619_47542 305
32 3300046675 Ga0495657_0000021 Ga0495657_0000021_62432_63352 305
33 3300048912 Ga0496109_0008122 Ga0496109_0008122_5528_6451 305
34 3300048917 Ga0496114_0025086 Ga0496114_0025086_355_1278 305
35 3300048918 Ga0496115_0000004 Ga0496115_0000004_136099_137022 305
36 3300048918 Ga0496115_0083570 Ga0496115_0083570_240_1187 305
37 3300048920 Ga0496117_0001638 Ga0496117_0001638_12644_13567 305
38 3300053119 Ga0500595_026098 Ga0500595_026098_742_1665 305
39 3300005354 Ga0070675_100131589 Ga0070675_1001315891 306
40 3300005356 Ga0070674_100000158 Ga0070674_10000015813 306
41 3300005365 Ga0070688_100120624 Ga0070688_1001206242 306
42 3300005468 Ga0070707_100130533 Ga0070707_1001305333 306
43 3300006175 Ga0070712_100000061 Ga0070712_1000000612 306
44 3300006847 Ga0075431_100255161 Ga0075431_1002551612 306
45 3300009094 Ga0111539_10092692 Ga0111539_100926923 306
46 3300009147 Ga0114129_10005255 Ga0114129_1000525515 306
47 3300025915 Ga0207693_10000201 Ga0207693_100002012 306
48 3300025918 Ga0207662_10039712 Ga0207662_100397122 306
49 3300025922 Ga0207646_10112044 Ga0207646_101120443 306
50 3300025926 Ga0207659_10094666 Ga0207659_100946661 306
51 3300025937 Ga0207669_10000083 Ga0207669_1000008323 306
52 3300032005 Ga0307411_10364374 Ga0307411_103643742 306
53 3300046474 Ga0495605_0042167 Ga0495605_0042167_83_1009 306
54 3300048909 Ga0496106_0289534 Ga0496106_0289534_255_1181 306
55 3300048912 Ga0496109_0001480 Ga0496109_0001480_4446_5372 306
56 3300048915 Ga0496112_0001307 Ga0496112_0001307_1151_2077 306
57 3300049742 Ga0501080_0003636 Ga0501080_0003636_5082_6008 306
58 3300050508 nmdc:mga09592_212107_c1 nmdc:mga09592_212107_c1_694_1620 306
59 3300050511 nmdc:mga08y16_135137_c1 nmdc:mga08y16_135137_c1_643_1569 306
60 3300005339 Ga0070660_100069962 Ga0070660_1000699623 307
61 3300005339 Ga0070660_100099251 Ga0070660_1000992513 307
62 3300005353 Ga0070669_100015020 Ga0070669_1000150202 307
63 3300005355 Ga0070671_100193678 Ga0070671_1001936782 307
64 3300005366 Ga0070659_100000003 Ga0070659_10000000374 307
65 3300005367 Ga0070667_100126873 Ga0070667_1001268732 307
66 3300005435 Ga0070714_100000026 Ga0070714_10000002664 307
67 3300005435 Ga0070714_100002361 Ga0070714_1000023616 307
68 3300005435 Ga0070714_100008290 Ga0070714_1000082909 307
69 3300005437 Ga0070710_10000001 Ga0070710_10000001291 307
70 3300005440 Ga0070705_100016817 Ga0070705_1000168172 307
71 3300005455 Ga0070663_100028484 Ga0070663_1000284842 307
72 3300005456 Ga0070678_100005721 Ga0070678_1000057213 307
73 3300005458 Ga0070681_10030037 Ga0070681_100300372 307
74 3300005530 Ga0070679_100037418 Ga0070679_1000374181 307
75 3300005535 Ga0070684_100047368 Ga0070684_1000473681 307
76 3300005544 Ga0070686_100017604 Ga0070686_1000176043 307
77 3300005549 Ga0070704_100033431 Ga0070704_1000334313 307
78 3300005616 Ga0068852_100085100 Ga0068852_1000851002 307
79 3300005843 Ga0068860_100003145 Ga0068860_1000031455 307
80 3300006237 Ga0097621_100080148 Ga0097621_1000801482 307
81 3300006880 Ga0075429_100066666 Ga0075429_1000666663 307
82 3300006880 Ga0075429_100129836 Ga0075429_1001298362 307
83 3300006881 Ga0068865_100201588 Ga0068865_1002015882 307
84 3300009098 Ga0105245_10695232 Ga0105245_106952322 307
85 3300009148 Ga0105243_10001387 Ga0105243_1000138715 307
86 3300009176 Ga0105242_10005685 Ga0105242_100056853 307
87 3300009551 Ga0105238_10400079 Ga0105238_104000791 307
88 3300009553 Ga0105249_10158058 Ga0105249_101580582 307
89 3300011119 Ga0105246_10002227 Ga0105246_100022277 307
90 3300013297 Ga0157378_10005390 Ga0157378_100053904 307
91 3300013308 Ga0157375_10088265 Ga0157375_100882651 307
92 3300014968 Ga0157379_10001684 Ga0157379_1000168413 307
93 3300025898 Ga0207692_10000004 Ga0207692_10000004377 307
94 3300025899 Ga0207642_10005941 Ga0207642_100059412 307
95 3300025912 Ga0207707_10026098 Ga0207707_100260982 307
96 3300025917 Ga0207660_10052428 Ga0207660_100524282 307
97 3300025919 Ga0207657_10078658 Ga0207657_100786582 307
98 3300025923 Ga0207681_10010983 Ga0207681_100109832 307
99 3300025929 Ga0207664_10000012 Ga0207664_10000012119 307
100 3300025929 Ga0207664_10000498 Ga0207664_1000049819 307
101 3300025932 Ga0207690_10000306 Ga0207690_100003067 307
102 3300025934 Ga0207686_10043194 Ga0207686_100431942 307
103 3300025937 Ga0207669_10061240 Ga0207669_100612402 307
104 3300025938 Ga0207704_10032328 Ga0207704_100323282 307
105 3300025944 Ga0207661_10021447 Ga0207661_100214475 307
106 3300025944 Ga0207661_10102928 Ga0207661_101029283 307
107 3300025960 Ga0207651_10289314 Ga0207651_102893141 307
108 3300025961 Ga0207712_10122832 Ga0207712_101228322 307
109 3300025986 Ga0207658_10116645 Ga0207658_101166452 307
110 3300026035 Ga0207703_10138283 Ga0207703_101382832 307
111 3300026067 Ga0207678_10024548 Ga0207678_100245483 307
112 3300026121 Ga0207683_10000068 Ga0207683_1000006810 307
113 3300028558 Ga0265326_10000094 Ga0265326_1000009411 307
114 3300028558 Ga0265326_10000094 Ga0265326_100000945 307
115 3300028563 Ga0265319_1002185 Ga0265319_10021855 307
116 3300028573 Ga0265334_10000134 Ga0265334_1000013429 307
117 3300028573 Ga0265334_10000134 Ga0265334_1000013435 307
118 3300028577 Ga0265318_10094075 Ga0265318_100940751 307
119 3300028800 Ga0265338_10010647 Ga0265338_100106476 307
120 3300028800 Ga0265338_10045765 Ga0265338_100457652 307
121 3300029957 Ga0265324_10003744 Ga0265324_100037444 307
122 3300029957 Ga0265324_10004756 Ga0265324_100047563 307
123 3300031240 Ga0265320_10043112 Ga0265320_100431122 307
124 3300048903 Ga0496100_0000254 Ga0496100_0000254_7564_8496 307
125 3300048903 Ga0496100_0009189 Ga0496100_0009189_2288_3232 307
126 3300048904 Ga0496101_0002622 Ga0496101_0002622_8603_9535 307
127 3300048904 Ga0496101_0002731 Ga0496101_0002731_7628_8572 307
128 3300048905 Ga0496102_0047677 Ga0496102_0047677_2469_3413 307
129 3300048905 Ga0496102_0197335 Ga0496102_0197335_330_1274 307
130 3300048907 Ga0496104_0011692 Ga0496104_0011692_74_1018 307
131 3300048907 Ga0496104_0443418 Ga0496104_0443418_115_1149 307
132 3300048908 Ga0496105_0110292 Ga0496105_0110292_1088_2032 307
133 3300048909 Ga0496106_0005829 Ga0496106_0005829_836_1780 307
134 3300048910 Ga0496107_0005567 Ga0496107_0005567_2323_3267 307
135 3300048915 Ga0496112_0301111 Ga0496112_0301111_144_1088 307
136 3300048917 Ga0496114_0004670 Ga0496114_0004670_6536_7480 307
137 3300050492 nmdc:mga0yw44_94344_c1 nmdc:mga0yw44_94344_c1_338_1270 307
138 3300050508 nmdc:mga09592_12283_c1 nmdc:mga09592_12283_c1_1584_2540 307
139 3300005330 Ga0070690_100210133 Ga0070690_1002101332 308
140 3300005354 Ga0070675_100255000 Ga0070675_1002550002 308
141 3300005468 Ga0070707_100022723 Ga0070707_1000227234 308
142 3300005468 Ga0070707_100142425 Ga0070707_1001424253 308
143 3300009101 Ga0105247_10096864 Ga0105247_100968642 308
144 3300009177 Ga0105248_10416764 Ga0105248_104167642 308
145 3300025900 Ga0207710_10056466 Ga0207710_100564662 308
146 3300025910 Ga0207684_10010615 Ga0207684_100106155 308
147 3300025922 Ga0207646_10060865 Ga0207646_100608652 308
148 3300025922 Ga0207646_10301394 Ga0207646_103013942 308
149 3300039093 Ga0400489_09071 Ga0400489_09071_15042_16022 308
150 3300049585 Ga0501069_0044823 Ga0501069_0044823_936_1916 308
151 3300049586 Ga0501070_0000124 Ga0501070_0000124_43683_44663 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

41

207

0.96

PF02780

Transketolase_C

Transketolase, C-terminal domain

217

339

0.95

PF17147

PFOR_II

Pyruvate:ferredoxin oxidoreductase core domain II

226

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.9303 2 305
7a9g-assembly1.cif.gz_BBB truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from mycobacterium tuberculosis with intermediate 2-acetyl-thiamine diphosphate 0.9231 2 305
8a29-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9227 2 302
2o1x-assembly2.cif.gz_D 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from deinococcus radiodurans 0.9207 2 303
8a45-assembly1.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9187 2 302
ID Description Score Start End Superfamily
af_Q58092_3_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9618 2 158 3.40.50.970
af_O50408_212_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9487 4 164 3.40.50.970
af_I1M1A4_399_568_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9273 2 165 3.40.50.970
af_D3ZHE7_301_494_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9234 2 173 3.40.50.970
af_Q8IDW0_828_997_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9118 2 163 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7D8BA50-F1-model_v4 deleted 0.9786 1 102
AF-K1RWP6-F1-model_v4 Transketolase central region (EC 1.2.4.4) 0.9707 4 141 GO:0003863
AF-A0A7K3IX52-F1-model_v4 Transketolase family protein 0.9694 2 135
AF-A0A382TYG3-F1-model_v4 Transketolase-like pyrimidine-binding domain-containing protein 0.9688 1 114
AF-A0A7Y3LJ63-F1-model_v4 Transketolase 0.9683 1 183 GO:0000287

Feature Viewer

pLDDT pTM Quality
94.62 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map