F211753

General Info

Members Datasets Scaffolds Average Seq Length
151 118 150 97

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10700063|Ga0207646_107000632
Length 111
Sequence MTRPAKSNSRSKPKLSAKPKFSFRLYVAGDAQNSAQAVVNLTAFCQAYLMDRHTIEVVNVFKEPKRALADGIFMTPTLVKLAPAPAPRRIVGTLSQVQPVMHAFGVEVVVA

Samples

Sample ID Description Type Environment
1 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
111 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
112 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
114 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
115 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
116 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
117 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
118 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 0
Rhizoplane 1.99
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10082189 3300005295 Bacteria 19748
2 Ga0070690_100005378 3300005330 Bacteria 7187
3 Ga0070690_100060041 3300005330 Bacteria 2446
4 Ga0070680_101640504 3300005336 Bacteria 557
5 Ga0070680_101763968 3300005336 Bacteria 536
6 Ga0070689_100034630 3300005340 Bacteria 3853
7 Ga0070691_10434056 3300005341 Bacteria 747
8 Ga0070687_101345299 3300005343 Unclassified 532
9 Ga0070692_10214136 3300005345 Bacteria 1135
10 Ga0070701_10014422 3300005438 Bacteria 3624
11 Ga0070701_11033588 3300005438 Unclassified 575
12 Ga0070705_100771073 3300005440 Bacteria 762
13 Ga0070700_100000356 3300005441 Bacteria 23508
14 Ga0070694_100135197 3300005444 Bacteria 1786
15 Ga0070694_100299821 3300005444 Bacteria 1231
16 Ga0070694_100806450 3300005444 Unclassified 770
17 Ga0070708_100834391 3300005445 Bacteria 866
18 Ga0070708_101513136 3300005445 Unclassified 625
19 Ga0070708_101773555 3300005445 Bacteria 573
20 Ga0070678_100058993 3300005456 Bacteria 2819
21 Ga0070678_101117460 3300005456 Unclassified 728
22 Ga0068867_100006118 3300005459 Bacteria 8518
23 Ga0068867_101307816 3300005459 Bacteria 669
24 Ga0070685_10103580 3300005466 Bacteria 1741
25 Ga0070706_101386138 3300005467 Unclassified 644
26 Ga0070699_101977514 3300005518 Unclassified 533
27 Ga0070697_100048695 3300005536 Bacteria 3437
28 Ga0070686_100001314 3300005544 Bacteria 14051
29 Ga0070695_100002299 3300005545 Bacteria 10955
30 Ga0070695_100705321 3300005545 Bacteria 801
31 Ga0070696_100111531 3300005546 Bacteria 1970
32 Ga0070696_100234011 3300005546 Bacteria 1383
33 Ga0070696_100967125 3300005546 Bacteria 710
34 Ga0070693_100007355 3300005547 Bacteria 5381
35 Ga0070704_100274344 3300005549 Bacteria 1394
36 Ga0070704_100295627 3300005549 Bacteria 1347
37 Ga0070702_100004215 3300005615 Bacteria 6541
38 Ga0068859_100138972 3300005617 Bacteria 2503
39 Ga0068859_101127403 3300005617 Unclassified 863
40 Ga0068859_101176491 3300005617 Bacteria 844
41 Ga0068864_101439463 3300005618 Bacteria 691
42 Ga0068866_10000691 3300005718 Bacteria 15315
43 Ga0068861_100027453 3300005719 Bacteria 4145
44 Ga0068870_10284878 3300005840 Bacteria 1037
45 Ga0068858_100007672 3300005842 Bacteria 10426
46 Ga0068860_100043191 3300005843 Bacteria 4302
47 Ga0068862_102048900 3300005844 Bacteria 583
48 Ga0075365_10001347 3300006038 Bacteria 11012
49 Ga0075365_11258905 3300006038 Unclassified 520
50 Ga0075364_10198921 3300006051 Unclassified 1358
51 Ga0075367_10089547 3300006178 Bacteria 1871
52 Ga0075367_10105389 3300006178 Bacteria 1727
53 Ga0075367_10144045 3300006178 Unclassified 1477
54 Ga0097621_100295540 3300006237 Bacteria 1429
55 Ga0068871_100040205 3300006358 Bacteria 3745
56 Ga0068871_100970306 3300006358 Unclassified 790
57 Ga0075430_100050565 3300006846 Bacteria 3504
58 Ga0075431_100047707 3300006847 Bacteria 4416
59 Ga0068865_100000481 3300006881 Bacteria 22330
60 Ga0075436_100850062 3300006914 Bacteria 681
61 Ga0097620_100138969 3300006931 Bacteria 2503
62 Ga0097620_101127507 3300006931 Unclassified 863
63 Ga0097620_101176681 3300006931 Bacteria 844
64 Ga0105245_10000569 3300009098 Bacteria 33604
65 Ga0105242_10013981 3300009176 Bacteria 6210
66 Ga0105242_10042826 3300009176 Unclassified 3659
67 Ga0105242_10544106 3300009176 Bacteria 1112
68 Ga0105248_10617511 3300009177 Bacteria 1223
69 Ga0105249_10394321 3300009553 Unclassified 1413
70 Ga0105239_12287370 3300010375 Unclassified 629
71 Ga0105246_11529675 3300011119 Unclassified 628
72 Ga0157374_10450833 3300013296 Bacteria 1288
73 Ga0157378_10006855 3300013297 Bacteria 9935
74 Ga0163162_11522387 3300013306 Unclassified 762
75 Ga0163163_10087661 3300014325 Bacteria 3123
76 Ga0157380_10010344 3300014326 Bacteria 6710
77 Ga0207642_10039606 3300025899 Bacteria 2049
78 Ga0207645_10320219 3300025907 Bacteria 1034
79 Ga0207643_10145055 3300025908 Bacteria 1420
80 Ga0207660_10640546 3300025917 Bacteria 866
81 Ga0207662_10750370 3300025918 Bacteria 686
82 Ga0207646_10700063 3300025922 Unclassified 906
83 Ga0207687_10679194 3300025927 Bacteria 873
84 Ga0207686_10136372 3300025934 Bacteria 1690
85 Ga0207686_10224710 3300025934 Unclassified 1358
86 Ga0207686_11662917 3300025934 Bacteria 528
87 Ga0207704_10458282 3300025938 Bacteria 1019
88 Ga0207689_10000173 3300025942 Bacteria 56390
89 Ga0207712_10166653 3300025961 Bacteria 1718
90 Ga0207712_10473714 3300025961 Unclassified 1066
91 Ga0207703_10438434 3300026035 Bacteria 1218
92 Ga0207708_10060018 3300026075 Bacteria 2903
93 Ga0207648_10000730 3300026089 Bacteria 36815
94 Ga0207676_10389872 3300026095 Bacteria 1299
95 Ga0207675_100000407 3300026118 Bacteria 41288
96 Ga0207683_10006934 3300026121 Bacteria 9703
97 Ga0207683_11112474 3300026121 Unclassified 733
98 Ga0209966_1113542 3300027695 Bacteria 618
99 Ga0268265_10070986 3300028380 Bacteria 2710
100 Ga0268264_10604397 3300028381 Bacteria 1081
101 Ga0265326_10205914 3300028558 Unclassified 565
102 Ga0265324_10084859 3300029957 Bacteria 1077
103 Ga0307511_10040264 3300030521 Bacteria 3973
104 Ga0265328_10003232 3300031239 Bacteria 7227
105 Ga0265320_10132146 3300031240 Bacteria 1134
106 Ga0265329_10001162 3300031242 Bacteria 12961
107 Ga0265340_10416746 3300031247 Unclassified 592
108 Ga0265327_10248957 3300031251 Unclassified 792
109 Ga0265316_10135072 3300031344 Bacteria 1856
110 Ga0307513_10077925 3300031456 Bacteria 3430
111 Ga0307513_10391574 3300031456 Bacteria 1126
112 Ga0265314_10000050 3300031711 Bacteria 189257
113 Ga0265314_10006155 3300031711 Bacteria 10662
114 Ga0373955_0261415 3300035172 Bacteria 1039
115 Ga0373961_0036491 3300035241 Unclassified 1400
116 Ga0373931_1006102 3300035691 Bacteria 564
117 Ga0373933_0399229 3300035724 Bacteria 897
118 Ga0373937_0082157 3300036401 Bacteria 2981
119 Ga0373937_0628475 3300036401 Bacteria 1019
120 Ga0439441_006953 3300042001 Bacteria 1809
121 Ga0439445_0147045 3300042004 Bacteria 685
122 Ga0439434_0168621 3300042435 Bacteria 730
123 Ga0439434_0365677 3300042435 Unclassified 505
124 Ga0453683_0118671 3300044673 Bacteria 1665
125 Ga0453684_0953080 3300044712 Bacteria 916
126 Ga0495580_0683392 3300046472 Bacteria 673
127 Ga0495672_0129716 3300047320 Unclassified 1328
128 Ga0496102_0432884 3300048905 Bacteria 1235
129 Ga0496110_1048736 3300048913 Unclassified 723
130 Ga0496114_1309390 3300048917 Unclassified 611
131 Ga0501038_0962506 3300049574 Unclassified 628
132 Ga0501047_0028716 3300049581 Bacteria 5364
133 Ga0501035_0017922 3300049822 Bacteria 6530
134 nmdc:mga00v17_72737_c1 3300050491 Bacteria 2133
135 nmdc:mga06z11_341492_c1 3300050494 Unclassified 895
136 nmdc:mga06z11_522604_c1 3300050494 Bacteria 720
137 nmdc:mga06z11_78904_c1 3300050494 Bacteria 1761
138 nmdc:mga0qj67_42757_c1 3300050509 Bacteria 3567
139 nmdc:mga06r32_80560_c1 3300050510 Bacteria 3169
140 nmdc:mga0rr50_657261_c1 3300050513 Bacteria 894
141 nmdc:mga08x19_752584_c1 3300050514 Bacteria 692
142 Ga0500647_0229398 3300053091 Unclassified 827
143 Ga0500641_0033809 3300053096 Bacteria 2032
144 Ga0500607_021816 3300053121 Bacteria 3604
145 Ga0500568_0002793 3300053139 Bacteria 10099
146 Ga0500586_020718 3300053145 Bacteria 2063
147 Ga0500630_285631 3300053159 Bacteria 548
148 Ga0500639_140499 3300053163 Bacteria 1130
149 Ga0500636_0000058 3300053177 Bacteria 53244
150 Ga0500637_0001188 3300053178 Bacteria 10845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_101127403 Ga0068859_1011274032 91
2 3300006931 Ga0097620_101127507 Ga0097620_1011275072 91
3 3300050494 nmdc:mga06z11_522604_c1 nmdc:mga06z11_522604_c1_54_329 91
4 iso_pu_bacteria 2643221646 2644257997 92
5 3300005618 Ga0068864_101439463 Ga0068864_1014394632 95
6 3300006358 Ga0068871_100970306 Ga0068871_1009703062 95
7 3300009177 Ga0105248_10617511 Ga0105248_106175112 95
8 3300013296 Ga0157374_10450833 Ga0157374_104508332 95
9 3300026095 Ga0207676_10389872 Ga0207676_103898722 95
10 3300030521 Ga0307511_10040264 Ga0307511_100402643 95
11 3300047320 Ga0495672_0129716 Ga0495672_0129716_192_491 95
12 3300053159 Ga0500630_285631 Ga0500630_285631_229_516 95
13 3300053163 Ga0500639_140499 Ga0500639_140499_576_863 95
14 3300005295 Ga0065707_10082189 Ga0065707_1008218912 96
15 3300005330 Ga0070690_100005378 Ga0070690_1000053785 96
16 3300005330 Ga0070690_100060041 Ga0070690_1000600412 96
17 3300005336 Ga0070680_101640504 Ga0070680_1016405041 96
18 3300005336 Ga0070680_101763968 Ga0070680_1017639681 96
19 3300005340 Ga0070689_100034630 Ga0070689_1000346302 96
20 3300005341 Ga0070691_10434056 Ga0070691_104340562 96
21 3300005343 Ga0070687_101345299 Ga0070687_1013452991 96
22 3300005345 Ga0070692_10214136 Ga0070692_102141362 96
23 3300005438 Ga0070701_10014422 Ga0070701_100144224 96
24 3300005438 Ga0070701_11033588 Ga0070701_110335882 96
25 3300005440 Ga0070705_100771073 Ga0070705_1007710731 96
26 3300005441 Ga0070700_100000356 Ga0070700_10000035620 96
27 3300005444 Ga0070694_100135197 Ga0070694_1001351971 96
28 3300005444 Ga0070694_100299821 Ga0070694_1002998212 96
29 3300005444 Ga0070694_100806450 Ga0070694_1008064502 96
30 3300005445 Ga0070708_100834391 Ga0070708_1008343912 96
31 3300005445 Ga0070708_101513136 Ga0070708_1015131362 96
32 3300005445 Ga0070708_101773555 Ga0070708_1017735552 96
33 3300005456 Ga0070678_100058993 Ga0070678_1000589932 96
34 3300005456 Ga0070678_101117460 Ga0070678_1011174602 96
35 3300005459 Ga0068867_100006118 Ga0068867_1000061182 96
36 3300005459 Ga0068867_101307816 Ga0068867_1013078162 96
37 3300005466 Ga0070685_10103580 Ga0070685_101035802 96
38 3300005467 Ga0070706_101386138 Ga0070706_1013861382 96
39 3300005518 Ga0070699_101977514 Ga0070699_1019775142 96
40 3300005536 Ga0070697_100048695 Ga0070697_1000486952 96
41 3300005544 Ga0070686_100001314 Ga0070686_1000013145 96
42 3300005545 Ga0070695_100002299 Ga0070695_1000022998 96
43 3300005545 Ga0070695_100705321 Ga0070695_1007053212 96
44 3300005546 Ga0070696_100111531 Ga0070696_1001115312 96
45 3300005546 Ga0070696_100234011 Ga0070696_1002340112 96
46 3300005546 Ga0070696_100967125 Ga0070696_1009671252 96
47 3300005547 Ga0070693_100007355 Ga0070693_1000073553 96
48 3300005549 Ga0070704_100274344 Ga0070704_1002743441 96
49 3300005549 Ga0070704_100295627 Ga0070704_1002956272 96
50 3300005615 Ga0070702_100004215 Ga0070702_1000042152 96
51 3300005617 Ga0068859_100138972 Ga0068859_1001389722 96
52 3300005617 Ga0068859_101176491 Ga0068859_1011764912 96
53 3300005718 Ga0068866_10000691 Ga0068866_100006914 96
54 3300005719 Ga0068861_100027453 Ga0068861_1000274532 96
55 3300005840 Ga0068870_10284878 Ga0068870_102848782 96
56 3300005842 Ga0068858_100007672 Ga0068858_1000076722 96
57 3300005843 Ga0068860_100043191 Ga0068860_1000431912 96
58 3300005844 Ga0068862_102048900 Ga0068862_1020489001 96
59 3300006038 Ga0075365_10001347 Ga0075365_100013473 96
60 3300006038 Ga0075365_11258905 Ga0075365_112589052 96
61 3300006051 Ga0075364_10198921 Ga0075364_101989212 96
62 3300006178 Ga0075367_10089547 Ga0075367_100895472 96
63 3300006178 Ga0075367_10105389 Ga0075367_101053892 96
64 3300006178 Ga0075367_10144045 Ga0075367_101440452 96
65 3300006237 Ga0097621_100295540 Ga0097621_1002955401 96
66 3300006358 Ga0068871_100040205 Ga0068871_1000402052 96
67 3300006846 Ga0075430_100050565 Ga0075430_1000505653 96
68 3300006847 Ga0075431_100047707 Ga0075431_1000477072 96
69 3300006881 Ga0068865_100000481 Ga0068865_10000048114 96
70 3300006914 Ga0075436_100850062 Ga0075436_1008500622 96
71 3300006931 Ga0097620_100138969 Ga0097620_1001389692 96
72 3300006931 Ga0097620_101176681 Ga0097620_1011766812 96
73 3300009098 Ga0105245_10000569 Ga0105245_1000056924 96
74 3300009176 Ga0105242_10013981 Ga0105242_100139812 96
75 3300009176 Ga0105242_10042826 Ga0105242_100428264 96
76 3300009176 Ga0105242_10544106 Ga0105242_105441062 96
77 3300009553 Ga0105249_10394321 Ga0105249_103943212 96
78 3300010375 Ga0105239_12287370 Ga0105239_122873702 96
79 3300011119 Ga0105246_11529675 Ga0105246_115296751 96
80 3300013297 Ga0157378_10006855 Ga0157378_100068552 96
81 3300013306 Ga0163162_11522387 Ga0163162_115223872 96
82 3300014325 Ga0163163_10087661 Ga0163163_100876612 96
83 3300014326 Ga0157380_10010344 Ga0157380_100103445 96
84 3300025899 Ga0207642_10039606 Ga0207642_100396062 96
85 3300025907 Ga0207645_10320219 Ga0207645_103202192 96
86 3300025908 Ga0207643_10145055 Ga0207643_101450552 96
87 3300025917 Ga0207660_10640546 Ga0207660_106405462 96
88 3300025918 Ga0207662_10750370 Ga0207662_107503702 96
89 3300025922 Ga0207646_10700063 Ga0207646_107000632 96
90 3300025927 Ga0207687_10679194 Ga0207687_106791942 96
91 3300025934 Ga0207686_10136372 Ga0207686_101363722 96
92 3300025934 Ga0207686_10224710 Ga0207686_102247102 96
93 3300025934 Ga0207686_11662917 Ga0207686_116629171 96
94 3300025938 Ga0207704_10458282 Ga0207704_104582822 96
95 3300025942 Ga0207689_10000173 Ga0207689_1000017343 96
96 3300025961 Ga0207712_10166653 Ga0207712_101666532 96
97 3300025961 Ga0207712_10473714 Ga0207712_104737142 96
98 3300026035 Ga0207703_10438434 Ga0207703_104384342 96
99 3300026075 Ga0207708_10060018 Ga0207708_100600182 96
100 3300026089 Ga0207648_10000730 Ga0207648_100007302 96
101 3300026118 Ga0207675_100000407 Ga0207675_10000040737 96
102 3300026121 Ga0207683_10006934 Ga0207683_100069342 96
103 3300026121 Ga0207683_11112474 Ga0207683_111124742 96
104 3300027695 Ga0209966_1113542 Ga0209966_11135421 96
105 3300028380 Ga0268265_10070986 Ga0268265_100709862 96
106 3300028381 Ga0268264_10604397 Ga0268264_106043972 96
107 3300028558 Ga0265326_10205914 Ga0265326_102059142 96
108 3300029957 Ga0265324_10084859 Ga0265324_100848591 96
109 3300031239 Ga0265328_10003232 Ga0265328_100032323 96
110 3300031240 Ga0265320_10132146 Ga0265320_101321462 96
111 3300031242 Ga0265329_10001162 Ga0265329_100011622 96
112 3300031247 Ga0265340_10416746 Ga0265340_104167462 96
113 3300031251 Ga0265327_10248957 Ga0265327_102489572 96
114 3300031344 Ga0265316_10135072 Ga0265316_101350722 96
115 3300031456 Ga0307513_10077925 Ga0307513_100779252 96
116 3300031456 Ga0307513_10391574 Ga0307513_103915742 96
117 3300031711 Ga0265314_10000050 Ga0265314_1000005083 96
118 3300031711 Ga0265314_10006155 Ga0265314_100061555 96
119 3300035172 Ga0373955_0261415 Ga0373955_0261415_515_805 96
120 3300035241 Ga0373961_0036491 Ga0373961_0036491_500_790 96
121 3300035691 Ga0373931_1006102 Ga0373931_1006102_27_317 96
122 3300035724 Ga0373933_0399229 Ga0373933_0399229_20_310 96
123 3300036401 Ga0373937_0082157 Ga0373937_0082157_440_730 96
124 3300036401 Ga0373937_0628475 Ga0373937_0628475_62_352 96
125 3300042001 Ga0439441_006953 Ga0439441_006953_505_804 96
126 3300042004 Ga0439445_0147045 Ga0439445_0147045_71_385 96
127 3300042435 Ga0439434_0168621 Ga0439434_0168621_153_467 96
128 3300042435 Ga0439434_0365677 Ga0439434_0365677_115_405 96
129 3300044673 Ga0453683_0118671 Ga0453683_0118671_649_939 96
130 3300044712 Ga0453684_0953080 Ga0453684_0953080_604_894 96
131 3300046472 Ga0495580_0683392 Ga0495580_0683392_313_603 96
132 3300048905 Ga0496102_0432884 Ga0496102_0432884_183_473 96
133 3300048913 Ga0496110_1048736 Ga0496110_1048736_358_648 96
134 3300048917 Ga0496114_1309390 Ga0496114_1309390_131_421 96
135 3300049574 Ga0501038_0962506 Ga0501038_0962506_248_550 96
136 3300049581 Ga0501047_0028716 Ga0501047_0028716_1777_2079 96
137 3300049822 Ga0501035_0017922 Ga0501035_0017922_3903_4205 96
138 3300050491 nmdc:mga00v17_72737_c1 nmdc:mga00v17_72737_c1_937_1227 96
139 3300050494 nmdc:mga06z11_341492_c1 nmdc:mga06z11_341492_c1_543_836 96
140 3300050494 nmdc:mga06z11_78904_c1 nmdc:mga06z11_78904_c1_74_364 96
141 3300050509 nmdc:mga0qj67_42757_c1 nmdc:mga0qj67_42757_c1_1570_1896 96
142 3300050510 nmdc:mga06r32_80560_c1 nmdc:mga06r32_80560_c1_2833_3159 96
143 3300050513 nmdc:mga0rr50_657261_c1 nmdc:mga0rr50_657261_c1_306_596 96
144 3300050514 nmdc:mga08x19_752584_c1 nmdc:mga08x19_752584_c1_197_487 96
145 3300053091 Ga0500647_0229398 Ga0500647_0229398_353_643 96
146 3300053096 Ga0500641_0033809 Ga0500641_0033809_1445_1735 96
147 3300053121 Ga0500607_021816 Ga0500607_021816_168_458 96
148 3300053139 Ga0500568_0002793 Ga0500568_0002793_7423_7728 96
149 3300053145 Ga0500586_020718 Ga0500586_020718_1564_1854 96
150 3300053177 Ga0500636_0000058 Ga0500636_0000058_20115_20405 96
151 3300053178 Ga0500637_0001188 Ga0500637_0001188_4769_5059 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

24

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.9535 5 92
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.9275 6 91
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.9233 5 92
8fwj-assembly1.cif.gz_M structure of dodecameric kaic-rs-s413e/s414e complexed with kaib-rs solved by cryo-em 0.9166 8 87
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.8884 6 91
ID Description Score Start End Superfamily
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9545 5 89 3.40.30.10
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9132 5 89 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9089 7 91 3.40.30.10
5jwqD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.875 9 95 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8708 7 91 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A856MFN3-F1-model_v4 Circadian clock protein KaiB 0.9965 4 90 GO:0048511
AF-A0A522VU99-F1-model_v4 Circadian clock protein KaiB 0.9964 1 96 GO:0048511
AF-A0A0M1JR17-F1-model_v4 Circadian clock protein KaiB 0.9959 6 90 GO:0048511
AF-A0A7Y5HYY7-F1-model_v4 Circadian clock protein KaiB 0.9939 1 80 GO:0048511
AF-A0A2P6WDV4-F1-model_v4 Thiol-disulfide isomerase 0.9918 3 92 GO:0016853
GO:0048511

Feature Viewer

pLDDT pTM Quality
90.54 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map