F212387

General Info

Members Datasets Scaffolds Average Seq Length
151 89 141 223

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0008960|Ga0451576_0008960_4215_4991
Length 258
Sequence MIGVGGAASANAXXXXDRLPRSNPDSTTSVQEEAMRLLVVEDDRLLGDALQAGLTQAGYAVDWVRDGAAATEALADVALHGYAAVVLDLGLPKRDGLEVLRALRRRGSALPVLILTARDTVEDRIGGLDAGADDYLVKPFDMGELAARLRALVRRAEGRPAPVIECQGVRLDPAAHTVQVDGVAIDLSAKEFALLQVLMLNAGRVLSRGQLEQQLYNWDDETGSNTVEVYIHHLRRKLGRDLIRTIRGVGYLVGKDTP

Samples

Sample ID Description Type Environment
1 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
2 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
3 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
4 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
5 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
6 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
7 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
8 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
9 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
10 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
61 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
62 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
63 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
64 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
65 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
68 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
84 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
87 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0.66
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 0
Rhizosphere 56.95
Stem 0
Stem Tuber 0
Unclassified 40.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10022371 3300003316 Bacteria 4280
2 rootH1_10079960 3300003316 Bacteria 4845
3 rootH1_10079960 3300003323 Bacteria 8017
4 JGI26128J50194_1000114 3300003347 Bacteria 3271
5 Ga0006562J51391_1030485 3300003578 Bacteria 2389
6 Ga0058692_1000016 3300003856 Bacteria 275897
7 Ga0065703_1000124 3300005272 Bacteria 46241
8 Ga0065704_10183896 3300005289 Bacteria 1223
9 Ga0070669_100000923 3300005353 Bacteria 21392
10 Ga0070673_100051028 3300005364 Bacteria 3237
11 Ga0070679_100749716 3300005530 Bacteria 919
12 Ga0070665_100022973 3300005548 Bacteria 6280
13 Ga0075362_10084056 3300006177 Bacteria 1470
14 Ga0075430_100095546 3300006846 Bacteria 2484
15 Ga0105251_10038961 3300009011 Bacteria 2324
16 Ga0105244_10089198 3300009036 Bacteria 1518
17 Ga0105244_10232139 3300009036 Bacteria 863
18 Ga0105250_10062641 3300009092 Bacteria 1497
19 Ga0105250_10063277 3300009092 Bacteria 1489
20 Ga0105240_10135732 3300009093 Bacteria 2947
21 Ga0105247_10000973 3300009101 Bacteria 21633
22 Ga0114129_10576739 3300009147 Bacteria 1460
23 Ga0105243_10000179 3300009148 Bacteria 73496
24 Ga0157370_10099307 3300013104 Bacteria 2728
25 Ga0157376_10070701 3300014969 Bacteria 2963
26 Ga0163161_10026566 3300017792 Bacteria 4100
27 Ga0207696_1003115 3300025711 Bacteria 7730
28 Ga0207696_1015562 3300025711 Bacteria 2574
29 Ga0207655_1000700 3300025728 Bacteria 38875
30 Ga0207655_1000738 3300025728 Bacteria 36911
31 Ga0207713_1002945 3300025735 Bacteria 11904
32 Ga0207710_10000041 3300025900 Bacteria 228027
33 Ga0207695_10098016 3300025913 Bacteria 2931
34 Ga0207681_10007108 3300025923 Bacteria 6863
35 Ga0207709_10000166 3300025935 Bacteria 89679
36 Ga0207691_10163601 3300025940 Bacteria 1951
37 Ga0207651_10044523 3300025960 Bacteria 2971
38 Ga0209371_1000051 3300027312 Bacteria 276935
39 Ga0209995_1013863 3300027471 Bacteria 1321
40 Ga0209966_1000039 3300027695 Bacteria 54525
41 Ga0268266_10032506 3300028379 Bacteria 4432
42 Ga0265336_10000435 3300028666 Bacteria 25645
43 Ga0265336_10062666 3300028666 Bacteria 1115
44 Ga0265324_10000775 3300029957 Bacteria 21048
45 Ga0268256_1000052 3300030500 Bacteria 276525
46 Ga0265330_10133051 3300031235 Bacteria 1058
47 Ga0265328_10016631 3300031239 Bacteria 2858
48 Ga0265325_10002082 3300031241 Bacteria 13690
49 Ga0265325_10174376 3300031241 Bacteria 1005
50 Ga0265331_10008016 3300031250 Bacteria 6040
51 Ga0265331_10096732 3300031250 Bacteria 1362
52 Ga0265327_10001509 3300031251 Bacteria 28791
53 Ga0265327_10020230 3300031251 Bacteria 4062
54 Ga0265316_10050275 3300031344 Bacteria 3279
55 Ga0265316_10130272 3300031344 Bacteria 1895
56 Ga0307408_100512825 3300031548 Bacteria 1052
57 Ga0316575_10063833 3300031665 Bacteria 1474
58 Ga0265314_10022694 3300031711 Bacteria 4804
59 Ga0316582_0223048 3300036647 Unclassified 1289
60 Ga0400484_14442 3300038725 Bacteria 3941
61 Ga0400484_16900 3300038725 Bacteria 2409
62 Ga0400484_19825 3300038725 Bacteria 9659
63 Ga0400490_19862 3300038726 Bacteria 3102
64 Ga0400490_20117 3300038726 Bacteria 25705
65 Ga0400490_23550 3300038726 Bacteria 6071
66 Ga0400490_28534 3300038726 Bacteria 16823
67 Ga0400490_33484 3300038726 Bacteria 8617
68 Ga0400490_48303 3300038726 Bacteria 10811
69 Ga0400490_56679 3300038726 Bacteria 6168
70 Ga0400491_03921 3300038727 Unclassified 4105
71 Ga0400491_10243 3300038727 Bacteria 5487
72 Ga0400491_26968 3300038727 Bacteria 2968
73 Ga0400491_29488 3300038727 Bacteria 1188
74 Ga0400485_03478 3300038735 Unclassified 3484
75 Ga0400485_09825 3300038735 Bacteria 56959
76 Ga0400485_17217 3300038735 Bacteria 1604
77 Ga0400488_02069 3300038741 Bacteria 13683
78 Ga0400488_03795 3300038741 Bacteria 1875
79 Ga0400488_11726 3300038741 Bacteria 2432
80 Ga0400488_24686 3300038741 Bacteria 9586
81 Ga0400488_28148 3300038741 Bacteria 13763
82 Ga0400488_29345 3300038741 Bacteria 1378
83 Ga0400488_35678 3300038741 Bacteria 4194
84 Ga0400488_58592 3300038741 Bacteria 8638
85 Ga0400486_00698 3300038742 Bacteria 11125
86 Ga0400486_06134 3300038742 Bacteria 91302
87 Ga0400486_20478 3300038742 Bacteria 3745
88 Ga0400483_018336 3300039062 Bacteria 1620
89 Ga0400483_023347 3300039062 Bacteria 2334
90 Ga0400483_025460 3300039062 Bacteria 6817
91 Ga0400483_055846 3300039062 Bacteria 4469
92 Ga0400483_085695 3300039062 Bacteria 10440
93 Ga0400483_141261 3300039062 Bacteria 3035
94 Ga0400483_159937 3300039062 Bacteria 14167
95 Ga0400483_163945 3300039062 Bacteria 1030
96 Ga0400483_175182 3300039062 Bacteria 3381
97 Ga0400483_181553 3300039062 Bacteria 12373
98 Ga0400483_200048 3300039062 Bacteria 27579
99 Ga0400483_269680 3300039062 Bacteria 2589
100 Ga0400483_284611 3300039062 Bacteria 1989
101 Ga0400489_93344 3300039093 Bacteria 6256
102 Ga0400487_01857 3300039110 Bacteria 1497
103 Ga0400487_04121 3300039110 Bacteria 52000
104 Ga0400487_24791 3300039110 Bacteria 81428
105 Ga0400487_25687 3300039110 Bacteria 4755
106 Ga0400487_27133 3300039110 Bacteria 68082
107 Ga0400487_43736 3300039110 Bacteria 35405
108 Ga0400487_50517 3300039110 Bacteria 2873
109 Ga0400487_58427 3300039110 Bacteria 1318
110 Ga0400487_58820 3300039110 Bacteria 2614
111 Ga0451577_0008888 3300042876 Bacteria 9724
112 Ga0451577_0039410 3300042876 Bacteria 4246
113 Ga0451577_0325842 3300042876 Bacteria 1393
114 Ga0451577_0359878 3300042876 Bacteria 1320
115 Ga0451577_0847038 3300042876 Bacteria 825
116 Ga0466969_0004975 3300044656 Bacteria 7077
117 Ga0466965_0109399 3300044683 Bacteria 1419
118 Ga0466961_0261762 3300044693 Bacteria 1060
119 Ga0466964_0011713 3300044706 Bacteria 3317
120 Ga0453684_0000029 3300044712 Bacteria 757969
121 Ga0453684_0002918 3300044712 Bacteria 40083
122 Ga0453684_0003562 3300044712 Bacteria 34829
123 Ga0466968_0025944 3300044735 Bacteria 2403
124 Ga0466959_0043822 3300045049 Bacteria 3297
125 Ga0451576_0000168 3300045051 Bacteria 165624
126 Ga0451576_0008960 3300045051 Bacteria 11665
127 Ga0451576_0010097 3300045051 Bacteria 10871
128 Ga0451576_0365483 3300045051 Bacteria 1511
129 Ga0466967_0086502 3300045976 Bacteria 2840
130 Ga0495622_0053754 3300046557 Bacteria 1869
131 Ga0495667_0049681 3300046559 Bacteria 2769
132 Ga0501040_0000663 3300049576 Bacteria 21241
133 Ga0501040_0039921 3300049576 Bacteria 3193
134 Ga0501042_0015191 3300049578 Bacteria 5268
135 Ga0501042_0033710 3300049578 Bacteria 3630
136 nmdc:mga0qj67_344460_c1 3300050509 Unclassified 1205
137 nmdc:mga06r32_417477_c1 3300050510 Bacteria 1323
138 Ga0495601_0412706 3300053077 Bacteria 875
139 Ga0500619_000073 3300053154 Bacteria 28363
140 Ga0500645_000856 3300053730 Bacteria 17818
141 Ga0466962_0033774 3300061719 Bacteria 2448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10163601 Ga0207691_101636012 190
2 3300014969 Ga0157376_10070701 Ga0157376_100707014 210
3 iso_pu_bacteria 2551306352 2552746771 215
4 iso_pu_bacteria 2639762793 2640735458 215
5 iso_pu_bacteria 2675903507 2678232313 215
6 iso_pu_bacteria 2773857761 2774391005 215
7 iso_pu_bacteria 2773857770 2774439066 215
8 iso_pu_bacteria 2916699645 2916701677 215
9 iso_pu_bacteria 2919182534 2919185789 215
10 iso_pu_bacteria 2919506607 2919507483 215
11 3300003856 Ga0058692_1000016 Ga0058692_100001667 216
12 3300005272 Ga0065703_1000124 Ga0065703_100012431 216
13 3300005548 Ga0070665_100022973 Ga0070665_1000229733 216
14 3300006177 Ga0075362_10084056 Ga0075362_100840562 216
15 3300009011 Ga0105251_10038961 Ga0105251_100389612 216
16 3300009093 Ga0105240_10135732 Ga0105240_101357322 216
17 3300025913 Ga0207695_10098016 Ga0207695_100980162 216
18 3300027312 Ga0209371_1000051 Ga0209371_1000051199 216
19 3300028379 Ga0268266_10032506 Ga0268266_100325062 216
20 3300030500 Ga0268256_1000052 Ga0268256_100005267 216
21 3300046559 Ga0495667_0049681 Ga0495667_0049681_381_1064 216
22 3300053077 Ga0495601_0412706 Ga0495601_0412706_51_734 216
23 3300053154 Ga0500619_000073 Ga0500619_000073_11934_12620 216
24 iso_pu_bacteria 2984568884 2984570705 216
25 iso_pu_bacteria 8033232454 8033235043 216
26 3300003578 Ga0006562J51391_1030485 Ga0006562J51391_10304852 218
27 3300005289 Ga0065704_10183896 Ga0065704_101838962 218
28 3300005353 Ga0070669_100000923 Ga0070669_10000092317 218
29 3300005364 Ga0070673_100051028 Ga0070673_1000510282 218
30 3300009036 Ga0105244_10089198 Ga0105244_100891982 218
31 3300009036 Ga0105244_10232139 Ga0105244_102321392 218
32 3300009092 Ga0105250_10062641 Ga0105250_100626412 218
33 3300009092 Ga0105250_10063277 Ga0105250_100632772 218
34 3300009101 Ga0105247_10000973 Ga0105247_100009736 218
35 3300009148 Ga0105243_10000179 Ga0105243_1000017954 218
36 3300013104 Ga0157370_10099307 Ga0157370_100993073 218
37 3300017792 Ga0163161_10026566 Ga0163161_100265662 218
38 3300025711 Ga0207696_1003115 Ga0207696_10031154 218
39 3300025711 Ga0207696_1015562 Ga0207696_10155622 218
40 3300025728 Ga0207655_1000700 Ga0207655_100070017 218
41 3300025728 Ga0207655_1000738 Ga0207655_100073817 218
42 3300025735 Ga0207713_1002945 Ga0207713_10029455 218
43 3300025900 Ga0207710_10000041 Ga0207710_1000004123 218
44 3300025923 Ga0207681_10007108 Ga0207681_100071085 218
45 3300025935 Ga0207709_10000166 Ga0207709_1000016660 218
46 3300025960 Ga0207651_10044523 Ga0207651_100445232 218
47 3300036647 Ga0316582_0223048 Ga0316582_0223048_614_1270 218
48 iso_pu_bacteria 2744054655 2745161468 218
49 3300031239 Ga0265328_10016631 Ga0265328_100166312 220
50 3300031250 Ga0265331_10008016 Ga0265331_100080162 220
51 3300031250 Ga0265331_10096732 Ga0265331_100967321 220
52 3300031251 Ga0265327_10001509 Ga0265327_1000150917 220
53 3300031251 Ga0265327_10020230 Ga0265327_100202304 220
54 3300038741 Ga0400488_11726 Ga0400488_11726_1027_1689 220
55 3300039110 Ga0400487_43736 Ga0400487_43736_12240_12902 220
56 3300044656 Ga0466969_0004975 Ga0466969_0004975_5035_5706 220
57 3300044683 Ga0466965_0109399 Ga0466965_0109399_503_1174 220
58 3300044693 Ga0466961_0261762 Ga0466961_0261762_195_866 220
59 3300044706 Ga0466964_0011713 Ga0466964_0011713_1371_2042 220
60 3300044712 Ga0453684_0003562 Ga0453684_0003562_24682_25344 220
61 3300044735 Ga0466968_0025944 Ga0466968_0025944_1125_1796 220
62 3300045049 Ga0466959_0043822 Ga0466959_0043822_1675_2346 220
63 3300061719 Ga0466962_0033774 Ga0466962_0033774_1168_1839 220
64 3300006846 Ga0075430_100095546 Ga0075430_1000955462 221
65 3300009147 Ga0114129_10576739 Ga0114129_105767392 221
66 3300038725 Ga0400484_14442 Ga0400484_14442_2732_3397 221
67 3300038725 Ga0400484_16900 Ga0400484_16900_1239_1904 221
68 3300038726 Ga0400490_19862 Ga0400490_19862_570_1235 221
69 3300038726 Ga0400490_23550 Ga0400490_23550_3487_4152 221
70 3300038726 Ga0400490_28534 Ga0400490_28534_5132_5797 221
71 3300038726 Ga0400490_33484 Ga0400490_33484_6283_6948 221
72 3300038727 Ga0400491_10243 Ga0400491_10243_2181_2846 221
73 3300038727 Ga0400491_26968 Ga0400491_26968_1787_2452 221
74 3300038727 Ga0400491_29488 Ga0400491_29488_202_867 221
75 3300038735 Ga0400485_09825 Ga0400485_09825_6802_7467 221
76 3300038735 Ga0400485_17217 Ga0400485_17217_579_1244 221
77 3300038741 Ga0400488_03795 Ga0400488_03795_238_903 221
78 3300038741 Ga0400488_24686 Ga0400488_24686_8373_9038 221
79 3300038741 Ga0400488_28148 Ga0400488_28148_1633_2298 221
80 3300038741 Ga0400488_58592 Ga0400488_58592_1744_2409 221
81 3300038742 Ga0400486_06134 Ga0400486_06134_83977_84642 221
82 3300039062 Ga0400483_055846 Ga0400483_055846_3675_4340 221
83 3300039062 Ga0400483_085695 Ga0400483_085695_5979_6644 221
84 3300039062 Ga0400483_141261 Ga0400483_141261_329_994 221
85 3300039062 Ga0400483_159937 Ga0400483_159937_2548_3213 221
86 3300039062 Ga0400483_163945 Ga0400483_163945_180_845 221
87 3300039062 Ga0400483_175182 Ga0400483_175182_1127_1792 221
88 3300039062 Ga0400483_200048 Ga0400483_200048_23240_23905 221
89 3300039062 Ga0400483_284611 Ga0400483_284611_1005_1670 221
90 3300039110 Ga0400487_04121 Ga0400487_04121_48549_49214 221
91 3300039110 Ga0400487_25687 Ga0400487_25687_950_1615 221
92 3300039110 Ga0400487_27133 Ga0400487_27133_60169_60834 221
93 3300039110 Ga0400487_50517 Ga0400487_50517_1977_2642 221
94 3300039110 Ga0400487_58427 Ga0400487_58427_134_799 221
95 3300042876 Ga0451577_0847038 Ga0451577_0847038_107_781 221
96 3300044712 Ga0453684_0002918 Ga0453684_0002918_3110_3784 221
97 3300045051 Ga0451576_0008960 Ga0451576_0008960_4215_4991 221
98 3300045051 Ga0451576_0365483 Ga0451576_0365483_685_1350 221
99 3300045976 Ga0466967_0086502 Ga0466967_0086502_247_924 221
100 3300050509 nmdc:mga0qj67_344460_c1 nmdc:mga0qj67_344460_c1_205_873 221
101 3300050510 nmdc:mga06r32_417477_c1 nmdc:mga06r32_417477_c1_611_1279 221
102 3300053730 Ga0500645_000856 Ga0500645_000856_7231_7938 221
103 3300005530 Ga0070679_100749716 Ga0070679_1007497162 222
104 3300028666 Ga0265336_10000435 Ga0265336_100004355 222
105 3300028666 Ga0265336_10062666 Ga0265336_100626662 222
106 3300029957 Ga0265324_10000775 Ga0265324_100007755 222
107 3300031241 Ga0265325_10002082 Ga0265325_1000208213 222
108 3300031241 Ga0265325_10174376 Ga0265325_101743762 222
109 3300031344 Ga0265316_10050275 Ga0265316_100502754 222
110 3300031344 Ga0265316_10130272 Ga0265316_101302722 222
111 3300031548 Ga0307408_100512825 Ga0307408_1005128252 222
112 3300031665 Ga0316575_10063833 Ga0316575_100638332 222
113 3300031711 Ga0265314_10022694 Ga0265314_100226943 222
114 3300038725 Ga0400484_19825 Ga0400484_19825_6354_7022 222
115 3300038726 Ga0400490_20117 Ga0400490_20117_6863_7531 222
116 3300038726 Ga0400490_56679 Ga0400490_56679_3540_4208 222
117 3300038727 Ga0400491_03921 Ga0400491_03921_1032_1700 222
118 3300038741 Ga0400488_02069 Ga0400488_02069_11220_11888 222
119 3300038741 Ga0400488_29345 Ga0400488_29345_472_1140 222
120 3300038742 Ga0400486_20478 Ga0400486_20478_1467_2135 222
121 3300039062 Ga0400483_018336 Ga0400483_018336_593_1261 222
122 3300039062 Ga0400483_181553 Ga0400483_181553_8374_9096 222
123 3300039110 Ga0400487_01857 Ga0400487_01857_197_865 222
124 3300042876 Ga0451577_0359878 Ga0451577_0359878_427_1104 222
125 3300044712 Ga0453684_0000029 Ga0453684_0000029_38194_38862 222
126 3300003323 rootH1_10079960 rootH1_100799602 223
127 3300038735 Ga0400485_03478 Ga0400485_03478_1705_2376 223
128 3300038741 Ga0400488_35678 Ga0400488_35678_67_738 223
129 3300038742 Ga0400486_00698 Ga0400486_00698_2110_2781 223
130 3300039062 Ga0400483_025460 Ga0400483_025460_2412_3083 223
131 3300039062 Ga0400483_269680 Ga0400483_269680_1898_2569 223
132 3300039093 Ga0400489_93344 Ga0400489_93344_3657_4328 223
133 3300039110 Ga0400487_24791 Ga0400487_24791_6666_7337 223
134 3300039110 Ga0400487_58820 Ga0400487_58820_522_1193 223
135 3300042876 Ga0451577_0039410 Ga0451577_0039410_2615_3295 223
136 3300042876 Ga0451577_0325842 Ga0451577_0325842_473_1144 223
137 3300045051 Ga0451576_0000168 Ga0451576_0000168_17419_18090 223
138 3300045051 Ga0451576_0010097 Ga0451576_0010097_1517_2188 223
139 3300046557 Ga0495622_0053754 Ga0495622_0053754_413_1084 223
140 3300038726 Ga0400490_48303 Ga0400490_48303_5815_6489 224
141 3300039062 Ga0400483_023347 Ga0400483_023347_1133_1807 224
142 3300049576 Ga0501040_0039921 Ga0501040_0039921_2065_2739 224
143 3300049578 Ga0501042_0015191 Ga0501042_0015191_2949_3623 224
144 3300042876 Ga0451577_0008888 Ga0451577_0008888_3416_4102 225
145 3300003347 JGI26128J50194_1000114 JGI26128J50194_10001144 227
146 3300027471 Ga0209995_1013863 Ga0209995_10138632 227
147 3300027695 Ga0209966_1000039 Ga0209966_100003925 227
148 3300003316 rootH1_10022371 rootH1_100223714 229
149 3300031235 Ga0265330_10133051 Ga0265330_101330511 229
150 3300049576 Ga0501040_0000663 Ga0501040_0000663_16799_17488 229
151 3300049578 Ga0501042_0033710 Ga0501042_0033710_138_827 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

182

253

0.97

PF00072

Response_reg

Response regulator receiver domain

37

150

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9789 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9787 1 118
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9767 1 118
4qpj-assembly2.cif.gz_C 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain 0.9739 1 118
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9734 2 118
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9935 1 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.982 1 80 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9816 1 80 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9754 2 118 3.40.50.2300
af_P52076_121_218_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.974 121 217 1.10.10.10
ID Description Score Start End GO Terms
AF-V4P341-F1-model_v4 Transcriptional regulator 0.9863 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-V4P341-F1-model_v4 Transcriptional regulator 0.9773 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1Y6KS79-F1-model_v4 Transcriptional regulatory protein ZraR 0.9721 1 115 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2N3AJC3-F1-model_v4 Two-component system response regulator 0.9712 2 119 GO:0000160
GO:0005524
GO:0006355
GO:0016887
AF-A0A7U3C1Q9-F1-model_v4 deleted 0.9707 1 217

Feature Viewer

pLDDT pTM Quality
89.78 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map