F212528

General Info

Members Datasets Scaffolds Average Seq Length
151 93 148 164

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0392366|Ga0495631_0392366_16_567
Length 183
Sequence MMTTTTAMPTLARHATIATPPGPFTVIVGPDDDGRDVVLASGWTADIADLLPVIHPTLRPAESELVDDLPVLDVVEKFFAGDVRVIDDVVVRQRSGPFLQEAWEVLRTVPAGHPDTYASFAARCGRPAAVRAAANXXXXNAAALFVPCHRVLGSSGGLGGFRWGTPVKRWLLDHEAEHAPVPA

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
3 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
4 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
92 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
93 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.66
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 3.31
Rhizosphere 86.09
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10058394 3300003316 Bacteria 1323
2 rootH1_10058394 3300003323 Bacteria 7744
3 rootL2_10118810 3300003322 Bacteria 2087
4 Ga0068869_101056880 3300005334 Bacteria 709
5 Ga0070680_100955266 3300005336 Bacteria 740
6 Ga0070682_100815124 3300005337 Bacteria 759
7 Ga0068868_101351345 3300005338 Bacteria 663
8 Ga0070710_10549570 3300005437 Bacteria 797
9 Ga0070679_100264009 3300005530 Bacteria 1677
10 Ga0070684_100535449 3300005535 Bacteria 1086
11 Ga0068857_101363888 3300005577 Bacteria 689
12 Ga0068854_100447661 3300005578 Bacteria 1078
13 Ga0068862_100258873 3300005844 Bacteria 1588
14 Ga0081539_10002964 3300005985 Bacteria 22292
15 Ga0081539_10038709 3300005985 Bacteria 2822
16 Ga0075428_100522893 3300006844 Bacteria 1269
17 Ga0075431_100232258 3300006847 Bacteria 1879
18 Ga0111539_10166199 3300009094 Bacteria 2579
19 Ga0111539_10443072 3300009094 Bacteria 1512
20 Ga0114129_10015423 3300009147 Bacteria 10871
21 Ga0105238_10452762 3300009551 Bacteria 1280
22 Ga0157369_10407755 3300013105 Bacteria 1410
23 Ga0157372_11099048 3300013307 Bacteria 920
24 Ga0163163_11452629 3300014325 Bacteria 747
25 Ga0206353_11957023 3300020082 Bacteria 1162
26 Ga0207705_10325128 3300025909 Bacteria 1182
27 Ga0207660_10660124 3300025917 Bacteria 853
28 Ga0207652_10365407 3300025921 Bacteria 1302
29 Ga0207664_10742362 3300025929 Bacteria 883
30 Ga0207686_10477165 3300025934 Bacteria 964
31 Ga0207691_10242618 3300025940 Bacteria 1557
32 Ga0207689_10351268 3300025942 Bacteria 1226
33 Ga0207640_10314374 3300025981 Bacteria 1244
34 Ga0207703_10676172 3300026035 Bacteria 981
35 Ga0207639_10554427 3300026041 Bacteria 1055
36 Ga0207639_11588400 3300026041 Bacteria 614
37 Ga0207702_10903375 3300026078 Bacteria 875
38 Ga0207674_10544671 3300026116 Bacteria 1121
39 Ga0207698_10364107 3300026142 Bacteria 1370
40 Ga0207698_10992811 3300026142 Bacteria 850
41 Ga0307517_10071897 3300028786 Bacteria 3093
42 Ga0307517_10172493 3300028786 Bacteria 1418
43 Ga0307515_10002732 3300028794 Bacteria 37745
44 Ga0307515_10050631 3300028794 Bacteria 6214
45 Ga0307512_10071597 3300030522 Bacteria 2571
46 Ga0307512_10087185 3300030522 Bacteria 2199
47 Ga0307513_10053677 3300031456 Bacteria 4329
48 Ga0307508_10596416 3300031616 Bacteria 706
49 Ga0307516_10120074 3300031730 Bacteria 2420
50 Ga0307405_10081544 3300031731 Bacteria 2115
51 Ga0307405_10410211 3300031731 Bacteria 1063
52 Ga0307405_10822193 3300031731 Bacteria 780
53 Ga0307413_10048596 3300031824 Bacteria 2537
54 Ga0307413_11077780 3300031824 Bacteria 693
55 Ga0307413_11203042 3300031824 Bacteria 659
56 Ga0307518_10134795 3300031838 Bacteria 1731
57 Ga0307410_10131795 3300031852 Bacteria 1837
58 Ga0307410_10292417 3300031852 Bacteria 1282
59 Ga0307410_10436508 3300031852 Bacteria 1065
60 Ga0307410_10694590 3300031852 Bacteria 857
61 Ga0307406_10102890 3300031901 Bacteria 1949
62 Ga0307406_10129158 3300031901 Bacteria 1771
63 Ga0307406_10357729 3300031901 Bacteria 1143
64 Ga0307406_10878716 3300031901 Bacteria 762
65 Ga0307406_10970204 3300031901 Bacteria 727
66 Ga0307407_10007211 3300031903 Bacteria 5018
67 Ga0307407_10041566 3300031903 Bacteria 2572
68 Ga0307407_10084072 3300031903 Bacteria 1932
69 Ga0307407_10290632 3300031903 Bacteria 1136
70 Ga0307407_10338277 3300031903 Bacteria 1062
71 Ga0307407_10669076 3300031903 Bacteria 779
72 Ga0307407_10883638 3300031903 Bacteria 685
73 Ga0307407_10959223 3300031903 Bacteria 659
74 Ga0307407_11193784 3300031903 Bacteria 594
75 Ga0307412_11429501 3300031911 Bacteria 627
76 Ga0307409_100020059 3300031995 Bacteria 4545
77 Ga0307409_100045961 3300031995 Bacteria 3301
78 Ga0307409_100078424 3300031995 Bacteria 2657
79 Ga0307409_100091902 3300031995 Bacteria 2489
80 Ga0307409_100124097 3300031995 Bacteria 2193
81 Ga0307409_100436266 3300031995 Bacteria 1261
82 Ga0307409_101204682 3300031995 Bacteria 781
83 Ga0307416_100093744 3300032002 Bacteria 2587
84 Ga0307416_100103507 3300032002 Bacteria 2486
85 Ga0307416_100118944 3300032002 Bacteria 2349
86 Ga0307416_100659921 3300032002 Bacteria 1131
87 Ga0307416_102693322 3300032002 Bacteria 594
88 Ga0307414_10134058 3300032004 Bacteria 1928
89 Ga0307411_10062261 3300032005 Bacteria 2488
90 Ga0307411_10991959 3300032005 Bacteria 751
91 Ga0307415_100511996 3300032126 Bacteria 1051
92 Ga0307415_100676626 3300032126 Bacteria 928
93 Ga0307415_100695473 3300032126 Bacteria 917
94 Ga0307415_101022901 3300032126 Bacteria 769
95 Ga0395899_0186016 3300037312 Bacteria 1456
96 Ga0395900_0018618 3300037418 Bacteria 7082
97 Ga0395900_0028236 3300037418 Bacteria 5747
98 Ga0395900_0234506 3300037418 Bacteria 1844
99 Ga0395898_0045467 3300037466 Bacteria 4316
100 Ga0395898_0075623 3300037466 Bacteria 3253
101 Ga0395898_0157794 3300037466 Bacteria 2170
102 Ga0395901_0015286 3300038443 Bacteria 7810
103 Ga0395901_0043254 3300038443 Bacteria 4673
104 Ga0395901_0395589 3300038443 Bacteria 1420
105 Ga0466972_0334801 3300044658 Bacteria 708
106 Ga0466965_0029212 3300044683 Bacteria 2682
107 Ga0466965_0130676 3300044683 Bacteria 1302
108 Ga0466965_0499117 3300044683 Bacteria 682
109 Ga0466961_0072774 3300044693 Bacteria 2180
110 Ga0466961_0206860 3300044693 Bacteria 1212
111 Ga0466964_0327739 3300044706 Bacteria 780
112 Ga0466971_0118779 3300044719 Bacteria 1223
113 Ga0466970_0204280 3300044765 Bacteria 1100
114 Ga0466957_0289348 3300044842 Bacteria 1098
115 Ga0466957_0512604 3300044842 Bacteria 833
116 Ga0466960_0030987 3300044901 Bacteria 2465
117 Ga0466960_0172906 3300044901 Bacteria 1167
118 Ga0466960_0175556 3300044901 Bacteria 1159
119 Ga0466960_0188754 3300044901 Bacteria 1121
120 Ga0466959_0720976 3300045049 Bacteria 668
121 Ga0466958_0367097 3300045836 Bacteria 927
122 Ga0466967_0021824 3300045976 Bacteria 5210
123 Ga0466967_0100693 3300045976 Bacteria 2640
124 Ga0466967_0338675 3300045976 Bacteria 1454
125 Ga0466967_0588724 3300045976 Bacteria 1097
126 Ga0466967_0713838 3300045976 Bacteria 993
127 Ga0495631_0392366 3300046518 Bacteria 591
128 Ga0496100_0229754 3300048903 Bacteria 1365
129 Ga0496102_0309481 3300048905 Bacteria 1489
130 Ga0496108_0934268 3300048911 Bacteria 743
131 Ga0496110_0089061 3300048913 Bacteria 2758
132 Ga0496111_0734835 3300048914 Bacteria 717
133 Ga0501033_0979038 3300049570 Bacteria 566
134 Ga0501034_1085980 3300049571 Bacteria 682
135 Ga0501042_0316974 3300049578 Bacteria 1127
136 Ga0501043_0100551 3300049579 Bacteria 2273
137 Ga0501046_0561468 3300049580 Bacteria 813
138 Ga0501047_1053847 3300049581 Bacteria 626
139 Ga0501074_0175410 3300049590 Bacteria 1529
140 Ga0501035_0498152 3300049822 Bacteria 1003
141 Ga0501044_0571860 3300049823 Bacteria 1025
142 nmdc:mga05p37_30211_c1 3300050507 Bacteria 6611
143 nmdc:mga09592_218603_c1 3300050508 Bacteria 1651
144 nmdc:mga08y16_273442_c1 3300050511 Bacteria 1743
145 Ga0500568_0002424 3300053139 Bacteria 10987
146 Ga0500600_0028122 3300053149 Bacteria 3328
147 Ga0466962_0105783 3300061719 Bacteria 1353
148 Ga0466962_0284456 3300061719 Bacteria 816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0204280 Ga0466970_0204280_590_1054 131
2 3300049580 Ga0501046_0561468 Ga0501046_0561468_49_489 131
3 3300005985 Ga0081539_10002964 Ga0081539_1000296421 136
4 3300044842 Ga0466957_0512604 Ga0466957_0512604_56_592 137
5 3300037466 Ga0395898_0075623 Ga0395898_0075623_515_1018 138
6 3300038443 Ga0395901_0015286 Ga0395901_0015286_2242_2745 138
7 3300044901 Ga0466960_0172906 Ga0466960_0172906_600_1112 138
8 3300045976 Ga0466967_0021824 Ga0466967_0021824_1390_1896 141
9 3300045976 Ga0466967_0588724 Ga0466967_0588724_17_538 143
10 3300048905 Ga0496102_0309481 Ga0496102_0309481_392_925 143
11 3300048914 Ga0496111_0734835 Ga0496111_0734835_157_690 143
12 3300005336 Ga0070680_100955266 Ga0070680_1009552662 144
13 3300005530 Ga0070679_100264009 Ga0070679_1002640092 144
14 3300005535 Ga0070684_100535449 Ga0070684_1005354491 144
15 3300005578 Ga0068854_100447661 Ga0068854_1004476612 144
16 3300009551 Ga0105238_10452762 Ga0105238_104527622 144
17 3300013105 Ga0157369_10407755 Ga0157369_104077552 144
18 3300013307 Ga0157372_11099048 Ga0157372_110990482 144
19 3300025909 Ga0207705_10325128 Ga0207705_103251282 144
20 3300025917 Ga0207660_10660124 Ga0207660_106601242 144
21 3300025921 Ga0207652_10365407 Ga0207652_103654072 144
22 3300026078 Ga0207702_10903375 Ga0207702_109033752 144
23 3300031731 Ga0307405_10822193 Ga0307405_108221931 144
24 3300031852 Ga0307410_10292417 Ga0307410_102924172 144
25 3300031901 Ga0307406_10357729 Ga0307406_103577292 144
26 3300031901 Ga0307406_10970204 Ga0307406_109702041 144
27 3300031903 Ga0307407_10084072 Ga0307407_100840722 144
28 3300031903 Ga0307407_10338277 Ga0307407_103382771 144
29 3300031903 Ga0307407_11193784 Ga0307407_111937841 144
30 3300031995 Ga0307409_100045961 Ga0307409_1000459611 144
31 3300032002 Ga0307416_100659921 Ga0307416_1006599212 144
32 3300032004 Ga0307414_10134058 Ga0307414_101340582 144
33 3300032005 Ga0307411_10991959 Ga0307411_109919591 144
34 3300032126 Ga0307415_101022901 Ga0307415_1010229012 144
35 3300031995 Ga0307409_100436266 Ga0307409_1004362662 145
36 3300037418 Ga0395900_0018618 Ga0395900_0018618_3495_4034 145
37 3300037466 Ga0395898_0157794 Ga0395898_0157794_1083_1622 145
38 3300038443 Ga0395901_0395589 Ga0395901_0395589_714_1253 145
39 3300049578 Ga0501042_0316974 Ga0501042_0316974_59_595 145
40 3300031901 Ga0307406_10129158 Ga0307406_101291582 146
41 3300031903 Ga0307407_10290632 Ga0307407_102906321 146
42 3300031903 Ga0307407_10883638 Ga0307407_108836381 146
43 3300031903 Ga0307407_10959223 Ga0307407_109592231 146
44 3300031995 Ga0307409_100020059 Ga0307409_1000200592 146
45 3300032005 Ga0307411_10062261 Ga0307411_100622613 146
46 3300032126 Ga0307415_100695473 Ga0307415_1006954732 146
47 3300044901 Ga0466960_0030987 Ga0466960_0030987_1134_1679 146
48 3300045049 Ga0466959_0720976 Ga0466959_0720976_48_593 146
49 3300031903 Ga0307407_10007211 Ga0307407_100072112 147
50 3300005338 Ga0068868_101351345 Ga0068868_1013513451 148
51 3300026041 Ga0207639_11588400 Ga0207639_115884001 148
52 3300026142 Ga0207698_10992811 Ga0207698_109928111 148
53 3300031901 Ga0307406_10102890 Ga0307406_101028902 148
54 3300031995 Ga0307409_100091902 Ga0307409_1000919022 148
55 3300032002 Ga0307416_100093744 Ga0307416_1000937442 148
56 3300031903 Ga0307407_10041566 Ga0307407_100415662 149
57 3300026116 Ga0207674_10544671 Ga0207674_105446712 150
58 3300048903 Ga0496100_0229754 Ga0496100_0229754_84_608 150
59 3300025929 Ga0207664_10742362 Ga0207664_107423622 152
60 3300031852 Ga0307410_10436508 Ga0307410_104365082 153
61 3300031995 Ga0307409_100124097 Ga0307409_1001240972 153
62 3300032002 Ga0307416_100103507 Ga0307416_1001035072 153
63 3300031731 Ga0307405_10410211 Ga0307405_104102112 154
64 3300031824 Ga0307413_11203042 Ga0307413_112030421 154
65 3300031852 Ga0307410_10694590 Ga0307410_106945901 154
66 3300031901 Ga0307406_10878716 Ga0307406_108787162 154
67 3300031903 Ga0307407_10669076 Ga0307407_106690762 154
68 3300044706 Ga0466964_0327739 Ga0466964_0327739_22_522 154
69 3300044719 Ga0466971_0118779 Ga0466971_0118779_323_823 154
70 3300044842 Ga0466957_0289348 Ga0466957_0289348_519_1019 154
71 3300045836 Ga0466958_0367097 Ga0466958_0367097_40_540 154
72 3300045976 Ga0466967_0100693 Ga0466967_0100693_670_1170 154
73 3300061719 Ga0466962_0284456 Ga0466962_0284456_221_721 154
74 3300031824 Ga0307413_11077780 Ga0307413_110777801 156
75 3300020082 Ga0206353_11957023 Ga0206353_119570231 157
76 3300044658 Ga0466972_0334801 Ga0466972_0334801_128_634 157
77 3300032126 Ga0307415_100676626 Ga0307415_1006766261 158
78 iso_pu_bacteria 2795385472 2795791619 161
79 iso_pu_bacteria 2751185725 2753035484 162
80 iso_pu_bacteria 2751185792 2753326490 162
81 3300006847 Ga0075431_100232258 Ga0075431_1002322582 163
82 3300037418 Ga0395900_0028236 Ga0395900_0028236_1495_2001 163
83 3300049570 Ga0501033_0979038 Ga0501033_0979038_49_555 163
84 3300049571 Ga0501034_1085980 Ga0501034_1085980_16_522 163
85 3300049579 Ga0501043_0100551 Ga0501043_0100551_1756_2262 163
86 3300049581 Ga0501047_1053847 Ga0501047_1053847_67_573 163
87 3300049590 Ga0501074_0175410 Ga0501074_0175410_287_793 163
88 3300049822 Ga0501035_0498152 Ga0501035_0498152_252_758 163
89 3300049823 Ga0501044_0571860 Ga0501044_0571860_269_775 163
90 3300053139 Ga0500568_0002424 Ga0500568_0002424_8698_9255 163
91 3300003322 rootL2_10118810 rootL2_101188102 164
92 3300005334 Ga0068869_101056880 Ga0068869_1010568801 164
93 3300005337 Ga0070682_100815124 Ga0070682_1008151241 164
94 3300005437 Ga0070710_10549570 Ga0070710_105495702 164
95 3300005577 Ga0068857_101363888 Ga0068857_1013638881 164
96 3300005844 Ga0068862_100258873 Ga0068862_1002588732 164
97 3300006844 Ga0075428_100522893 Ga0075428_1005228932 164
98 3300009094 Ga0111539_10166199 Ga0111539_101661993 164
99 3300009094 Ga0111539_10443072 Ga0111539_104430722 164
100 3300009147 Ga0114129_10015423 Ga0114129_100154235 164
101 3300014325 Ga0163163_11452629 Ga0163163_114526291 164
102 3300025934 Ga0207686_10477165 Ga0207686_104771652 164
103 3300025940 Ga0207691_10242618 Ga0207691_102426182 164
104 3300025942 Ga0207689_10351268 Ga0207689_103512682 164
105 3300025981 Ga0207640_10314374 Ga0207640_103143742 164
106 3300026035 Ga0207703_10676172 Ga0207703_106761722 164
107 3300026041 Ga0207639_10554427 Ga0207639_105544272 164
108 3300026142 Ga0207698_10364107 Ga0207698_103641072 164
109 3300031838 Ga0307518_10134795 Ga0307518_101347952 164
110 3300031911 Ga0307412_11429501 Ga0307412_114295011 164
111 3300031995 Ga0307409_101204682 Ga0307409_1012046822 164
112 3300032002 Ga0307416_102693322 Ga0307416_1026933221 164
113 3300044683 Ga0466965_0029212 Ga0466965_0029212_878_1420 164
114 3300044683 Ga0466965_0130676 Ga0466965_0130676_65_607 164
115 3300044683 Ga0466965_0499117 Ga0466965_0499117_15_563 164
116 3300044693 Ga0466961_0072774 Ga0466961_0072774_279_821 164
117 3300044693 Ga0466961_0206860 Ga0466961_0206860_604_1146 164
118 3300044901 Ga0466960_0175556 Ga0466960_0175556_290_832 164
119 3300044901 Ga0466960_0188754 Ga0466960_0188754_86_643 164
120 3300045976 Ga0466967_0338675 Ga0466967_0338675_401_937 164
121 3300045976 Ga0466967_0713838 Ga0466967_0713838_305_847 164
122 3300046518 Ga0495631_0392366 Ga0495631_0392366_16_567 164
123 3300048911 Ga0496108_0934268 Ga0496108_0934268_190_687 164
124 3300048913 Ga0496110_0089061 Ga0496110_0089061_53_550 164
125 3300050507 nmdc:mga05p37_30211_c1 nmdc:mga05p37_30211_c1_689_1183 164
126 3300050508 nmdc:mga09592_218603_c1 nmdc:mga09592_218603_c1_816_1310 164
127 3300050511 nmdc:mga08y16_273442_c1 nmdc:mga08y16_273442_c1_1110_1646 164
128 3300061719 Ga0466962_0105783 Ga0466962_0105783_288_830 164
129 iso_pu_bacteria 2622736605 2623500437 164
130 3300003316 rootH1_10058394 rootH1_100583942 165
131 3300005985 Ga0081539_10038709 Ga0081539_100387093 165
132 3300028786 Ga0307517_10071897 Ga0307517_100718972 165
133 3300028786 Ga0307517_10172493 Ga0307517_101724932 165
134 3300028794 Ga0307515_10002732 Ga0307515_1000273239 165
135 3300028794 Ga0307515_10050631 Ga0307515_100506317 165
136 3300030522 Ga0307512_10071597 Ga0307512_100715972 165
137 3300030522 Ga0307512_10087185 Ga0307512_100871852 165
138 3300031456 Ga0307513_10053677 Ga0307513_100536773 165
139 3300031616 Ga0307508_10596416 Ga0307508_105964161 165
140 3300031730 Ga0307516_10120074 Ga0307516_101200742 165
141 3300031731 Ga0307405_10081544 Ga0307405_100815442 165
142 3300031824 Ga0307413_10048596 Ga0307413_100485962 165
143 3300031852 Ga0307410_10131795 Ga0307410_101317952 165
144 3300031995 Ga0307409_100078424 Ga0307409_1000784242 165
145 3300032002 Ga0307416_100118944 Ga0307416_1001189442 165
146 3300032126 Ga0307415_100511996 Ga0307415_1005119962 165
147 3300037312 Ga0395899_0186016 Ga0395899_0186016_198_707 165
148 3300037418 Ga0395900_0234506 Ga0395900_0234506_35_544 165
149 3300037466 Ga0395898_0045467 Ga0395898_0045467_2666_3175 165
150 3300038443 Ga0395901_0043254 Ga0395901_0043254_77_586 165
151 3300053149 Ga0500600_0028122 Ga0500600_0028122_103_600 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

97

177

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8999 3 164
4enn-assembly1.cif.gz_A crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine 0.884 85 162
3ezw-assembly1.cif.gz_B crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.8805 2 28
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8744 3 164
7dqr-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii methylated o6-methylguanine methyltransferase 0.8645 1 162
ID Description Score Start End Superfamily
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9612 81 165 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9563 80 163 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9503 81 165 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9433 81 165 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 81 165 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A317JT22-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase 0.9947 2 164 GO:0003908
GO:0006281
GO:0032259
AF-A0A1C6V941-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.9946 2 163 GO:0003908
GO:0006281
GO:0032259
AF-A0A3D9ZIH7-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.9946 3 163 GO:0003908
GO:0006281
GO:0032259
AF-A0A4P6EWD6-F1-model_v4 Methylated-DNA--[protein]-cysteine S-methyltransferase 0.993 56 164 GO:0003908
GO:0006281
GO:0032259
AF-A0A2W4J0T5-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase 0.9921 18 164 GO:0003908
GO:0006281
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map