F212657

General Info

Members Datasets Scaffolds Average Seq Length
151 118 302 165

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0049175|Ga0496123_0049175_1665_2186
Length 165
Sequence MTDESASLDPVELGAYFALIEVSSLLRHAVELQLKKAGGLSYVQFQLLATLGDAPAGSMRMTDLADGVVYSRSGLTHQAVTRAPSVDDERSVTVTITEAGRAVLAKVFPGHIAVLKKMFFAPLERADVEELARSLSAVRDHMRATPPRSAAPRRRGGRSSRAGDS

Samples

Sample ID Description Type Environment
1 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
31 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
39 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
40 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
41 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
51 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
52 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
53 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
54 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
55 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
56 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
57 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
58 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
59 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
79 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
80 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
81 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
82 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
83 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
84 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
85 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
86 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
87 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
88 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
89 2808606372 Agromyces sp. 23-23 Isolate Unclassified
90 2808606394 Promicromonospora sp. C35 Isolate Unclassified
91 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
92 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
93 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
94 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
95 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
96 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
97 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
98 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
99 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
100 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
101 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
102 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
103 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
104 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
105 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
106 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
107 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
108 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
109 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
110 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
111 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
112 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
113 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
114 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
115 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
116 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
117 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
118 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 0
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 15.89
Nodule 0
Rhizoplane 3.97
Rhizosphere 47.02
Stem 0
Stem Tuber 0.66
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496123_0049175 3300048926 Bacteria 2830
2 JGI25162J39368_1006719 3300002737 Bacteria 1925
3 JGI25164J39214_1000385 3300002772 Bacteria 26010
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 Ga0055539_1000006 3300003752 Bacteria 580055
6 Ga0055533_1000002 3300003756 Bacteria 1196393
7 Ga0055525_1000241 3300003759 Bacteria 56036
8 Ga0070666_10424394 3300005335 Bacteria 958
9 Ga0068868_100500545 3300005338 Bacteria 1064
10 Ga0068868_100665064 3300005338 Bacteria 929
11 Ga0070667_100471888 3300005367 Bacteria 1148
12 Ga0068863_100116598 3300005841 Bacteria 2545
13 Ga0075364_10100087 3300006051 Bacteria 1930
14 Ga0105251_10111507 3300009011 Bacteria 1246
15 Ga0105246_10069976 3300011119 Bacteria 2466
16 Ga0157369_10041895 3300013105 Bacteria 4997
17 Ga0157369_10981108 3300013105 Bacteria 865
18 Ga0163162_10247619 3300013306 Bacteria 1914
19 Ga0157372_10687820 3300013307 Bacteria 1190
20 Ga0163163_10405230 3300014325 Bacteria 1422
21 Ga0209566_100032 3300025225 Bacteria 338313
22 Ga0209674_100001 3300025226 Bacteria 4013750
23 Ga0209563_100001 3300025230 Bacteria 4013775
24 Ga0209563_100702 3300025230 Bacteria 10489
25 Ga0207427_100041 3300025231 Bacteria 263659
26 Ga0209437_100267 3300025233 Bacteria 79455
27 Ga0209677_100001 3300025253 Bacteria 4013787
28 Ga0209233_1000014 3300025261 Bacteria 996641
29 Ga0207647_10370535 3300025904 Bacteria 809
30 Ga0207658_10224557 3300025986 Bacteria 1582
31 Ga0207677_10507646 3300026023 Bacteria 1044
32 Ga0207641_10097350 3300026088 Bacteria 2586
33 Ga0314311_1099752 3300030733 Bacteria 812
34 Ga0307514_10006675 3300031649 Bacteria 10007
35 Ga0307410_10076159 3300031852 Bacteria 2341
36 Ga0307406_10001673 3300031901 Bacteria 12187
37 Ga0307407_10726783 3300031903 Bacteria 750
38 Ga0307409_100980590 3300031995 Bacteria 862
39 Ga0307409_101862772 3300031995 Bacteria 631
40 Ga0307416_100181931 3300032002 Bacteria 1971
41 Ga0307414_11367174 3300032004 Bacteria 658
42 Ga0451793_1044995 3300041452 Bacteria 845
43 Ga0451797_0074411 3300041453 Bacteria 983
44 Ga0451797_0115390 3300041453 Bacteria 620
45 Ga0451807_0400443 3300041486 Bacteria 1487
46 Ga0451853_4051880 3300041512 Bacteria 540
47 Ga0466972_0016984 3300044658 Bacteria 3641
48 Ga0466972_0046835 3300044658 Bacteria 2092
49 Ga0466965_0009128 3300044683 Bacteria 4603
50 Ga0466965_0171468 3300044683 Bacteria 1142
51 Ga0466966_0024193 3300044684 Bacteria 3975
52 Ga0466961_0337487 3300044693 Bacteria 918
53 Ga0466970_0051251 3300044765 Bacteria 2202
54 Ga0466957_0141957 3300044842 Bacteria 1548
55 Ga0466960_0018531 3300044901 Bacteria 3053
56 Ga0466960_0030830 3300044901 Bacteria 2470
57 Ga0466959_0019793 3300045049 Bacteria 4952
58 Ga0495609_0183553 3300046538 Bacteria 880
59 Ga0495600_0425733 3300046809 Bacteria 823
60 Ga0495675_0106108 3300047444 Bacteria 1756
61 Ga0496101_0452542 3300048904 Bacteria 1013
62 Ga0496102_1592401 3300048905 Bacteria 571
63 Ga0496117_0001996 3300048920 Bacteria 27057
64 Ga0496117_0002355 3300048920 Bacteria 24155
65 Ga0496117_0014908 3300048920 Bacteria 6665
66 Ga0496118_0000290 3300048921 Bacteria 87438
67 Ga0496119_0000406 3300048922 Bacteria 59160
68 Ga0496119_0013475 3300048922 Bacteria 6506
69 Ga0496119_0090717 3300048922 Bacteria 1737
70 Ga0496119_0114472 3300048922 Bacteria 1492
71 Ga0496120_0001223 3300048923 Bacteria 32482
72 Ga0496120_0033811 3300048923 Bacteria 3069
73 Ga0496120_0357314 3300048923 Bacteria 655
74 Ga0496122_0000098 3300048925 Bacteria 198547
75 Ga0496122_0001827 3300048925 Bacteria 32452
76 Ga0496122_0016935 3300048925 Bacteria 6849
77 Ga0496122_0038946 3300048925 Bacteria 3798
78 Ga0496122_0040017 3300048925 Bacteria 3732
79 Ga0496122_0214661 3300048925 Bacteria 1110
80 Ga0496123_0000420 3300048926 Bacteria 77105
81 Ga0496123_0005099 3300048926 Bacteria 13411
82 Ga0496124_0000040 3300048927 Bacteria 307061
83 Ga0496124_0007401 3300048927 Bacteria 11676
84 Ga0496124_0080262 3300048927 Bacteria 2685
85 Ga0496124_0378828 3300048927 Bacteria 990
86 Ga0496125_0002794 3300048928 Bacteria 22070
87 Ga0496125_0007234 3300048928 Bacteria 11826
88 Ga0496126_0433268 3300048929 Bacteria 1061
89 Ga0501032_0082529 3300049569 Bacteria 2138
90 Ga0501033_0008362 3300049570 Bacteria 8013
91 Ga0501033_0028671 3300049570 Bacteria 4182
92 Ga0501034_0027081 3300049571 Bacteria 5832
93 Ga0501036_0053503 3300049572 Bacteria 3418
94 Ga0501038_0171123 3300049574 Bacteria 1758
95 Ga0501042_0127985 3300049578 Bacteria 1829
96 Ga0501043_0082908 3300049579 Bacteria 2521
97 Ga0501046_0006076 3300049580 Bacteria 10744
98 Ga0501046_0027961 3300049580 Bacteria 4596
99 Ga0501047_0000312 3300049581 Bacteria 56050
100 Ga0501048_0006665 3300049582 Bacteria 8772
101 Ga0501073_0776969 3300049589 Bacteria 660
102 Ga0501080_0490408 3300049742 Bacteria 1099
103 Ga0501035_0008763 3300049822 Bacteria 9417
104 Ga0501035_0040178 3300049822 Bacteria 4229
105 Ga0501044_0032085 3300049823 Bacteria 5522
106 nmdc:mga00v17_21243_c1 3300050491 Bacteria 3730
107 Ga0500635_0000002 3300053080 Bacteria 265613
108 Ga0500559_0004435 3300053136 Bacteria 6666
109 Ga0500559_0005733 3300053136 Bacteria 5674
110 Ga0500559_0243998 3300053136 Bacteria 846
111 Ga0500573_0000154 3300053140 Bacteria 27843
112 Ga0500573_0051747 3300053140 Bacteria 2362
113 Ga0500573_0321393 3300053140 Bacteria 764
114 Ga0500577_0106449 3300053142 Bacteria 1152
115 2644182626 2643221632 Bacteria 3406696
116 2738694613 2738541272 Bacteria 6848551
117 2739325990 2738543027 Bacteria 6409078
118 2739608615 2739367654 Bacteria 6049412
119 2753302953 2751185788 Bacteria 4541048
120 2758224457 2757320536 Bacteria 3629334
121 2760304008 2758568522 Bacteria 5953541
122 2808900942 2808606372 Bacteria 4649509
123 2809030396 2808606394 Bacteria 6248540
124 2812364985 2811994880 Bacteria 4147780
125 2844854266 2844852863 Bacteria 3849151
126 2857720504 2857720070 Bacteria 3189373
127 2857725530 2857723135 Bacteria 4217853
128 2857731356 2857729791 Bacteria 4040535
129 2857734764 2857733635 Bacteria 3532004
130 2870622415 2870622029 Bacteria 3643329
131 2884763800 2884763398 Bacteria 4091164
132 2897562372 2897561785 Bacteria 3256946
133 2904502236 2904501621 Bacteria 3401437
134 2908677248 2908674828 Bacteria 3382763
135 2909076179 2909074476 Bacteria 3436050
136 2919042290 2919039151 Bacteria 3391018
137 2919042624 2919042368 Bacteria 3905917
138 2928104933 2928104781 Bacteria 3877447
139 2928122103 2928121344 Bacteria 3972376
140 2928503199 2928500415 Bacteria 3384541
141 2945945583 2945941187 Bacteria 4682474
142 2945970025 2945968032 Bacteria 4111363
143 2946042395 2946041624 Bacteria 4191385
144 2946082790 2946080515 Bacteria 4310960
145 2964328043 2964326757 Bacteria 3290868
146 2966922976 2966921586 Bacteria 3092803
147 2977265871 2977264416 Bacteria 3750737
148 2984555095 2984551494 Bacteria 3877562
149 8004182995 8004182704 Bacteria 3391155
150 8056038715 8056037122 Bacteria 3854319
151 8056582806 8056579771 Bacteria 5840325
152 Ga0496123_0049175
153 JGI25162J39368_1006719
154 JGI25164J39214_1000385
155 JGI25165J46597_1000014
156 Ga0055539_1000006
157 Ga0055533_1000002
158 Ga0055525_1000241
159 Ga0070666_10424394
160 Ga0068868_100500545
161 Ga0068868_100665064
162 Ga0070667_100471888
163 Ga0068863_100116598
164 Ga0075364_10100087
165 Ga0105251_10111507
166 Ga0105246_10069976
167 Ga0157369_10041895
168 Ga0157369_10981108
169 Ga0163162_10247619
170 Ga0157372_10687820
171 Ga0163163_10405230
172 Ga0209566_100032
173 Ga0209674_100001
174 Ga0209563_100001
175 Ga0209563_100702
176 Ga0207427_100041
177 Ga0209437_100267
178 Ga0209677_100001
179 Ga0209233_1000014
180 Ga0207647_10370535
181 Ga0207658_10224557
182 Ga0207677_10507646
183 Ga0207641_10097350
184 Ga0314311_1099752
185 Ga0307514_10006675
186 Ga0307410_10076159
187 Ga0307406_10001673
188 Ga0307407_10726783
189 Ga0307409_100980590
190 Ga0307409_101862772
191 Ga0307416_100181931
192 Ga0307414_11367174
193 Ga0451793_1044995
194 Ga0451797_0074411
195 Ga0451797_0115390
196 Ga0451807_0400443
197 Ga0451853_4051880
198 Ga0466972_0016984
199 Ga0466972_0046835
200 Ga0466965_0009128
201 Ga0466965_0171468
202 Ga0466966_0024193
203 Ga0466961_0337487
204 Ga0466970_0051251
205 Ga0466957_0141957
206 Ga0466960_0018531
207 Ga0466960_0030830
208 Ga0466959_0019793
209 Ga0495609_0183553
210 Ga0495600_0425733
211 Ga0495675_0106108
212 Ga0496101_0452542
213 Ga0496102_1592401
214 Ga0496117_0001996
215 Ga0496117_0002355
216 Ga0496117_0014908
217 Ga0496118_0000290
218 Ga0496119_0000406
219 Ga0496119_0013475
220 Ga0496119_0090717
221 Ga0496119_0114472
222 Ga0496120_0001223
223 Ga0496120_0033811
224 Ga0496120_0357314
225 Ga0496122_0000098
226 Ga0496122_0001827
227 Ga0496122_0016935
228 Ga0496122_0038946
229 Ga0496122_0040017
230 Ga0496122_0214661
231 Ga0496123_0000420
232 Ga0496123_0005099
233 Ga0496124_0000040
234 Ga0496124_0007401
235 Ga0496124_0080262
236 Ga0496124_0378828
237 Ga0496125_0002794
238 Ga0496125_0007234
239 Ga0496126_0433268
240 Ga0501032_0082529
241 Ga0501033_0008362
242 Ga0501033_0028671
243 Ga0501034_0027081
244 Ga0501036_0053503
245 Ga0501038_0171123
246 Ga0501042_0127985
247 Ga0501043_0082908
248 Ga0501046_0006076
249 Ga0501046_0027961
250 Ga0501047_0000312
251 Ga0501048_0006665
252 Ga0501073_0776969
253 Ga0501080_0490408
254 Ga0501035_0008763
255 Ga0501035_0040178
256 Ga0501044_0032085
257 nmdc:mga00v17_21243_c1
258 Ga0500635_0000002
259 Ga0500559_0004435
260 Ga0500559_0005733
261 Ga0500559_0243998
262 Ga0500573_0000154
263 Ga0500573_0051747
264 Ga0500573_0321393
265 Ga0500577_0106449
266 2644182626
267 2738694613
268 2739325990
269 2739608615
270 2753302953
271 2758224457
272 2760304008
273 2808900942
274 2809030396
275 2812364985
276 2844854266
277 2857720504
278 2857725530
279 2857731356
280 2857734764
281 2870622415
282 2884763800
283 2897562372
284 2904502236
285 2908677248
286 2909076179
287 2919042290
288 2919042624
289 2928104933
290 2928122103
291 2928503199
292 2945945583
293 2945970025
294 2946042395
295 2946082790
296 2964328043
297 2966922976
298 2977265871
299 2984555095
300 8004182995
301 8056038715
302 8056582806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9475 6 152
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9436 7 157
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9417 5 156
5w1e-assembly1.cif.gz_A pobr in complex with phb 0.9361 43 105
3zpl-assembly2.cif.gz_E crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9309 2 157
ID Description Score Start End Superfamily
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9646 5 150 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9427 6 152 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9379 43 105 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 40 105 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9245 6 152 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G9F6K0-F1-model_v4 deleted 0.9735 16 146
AF-A0A1H9XTY2-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9698 4 146 GO:0003677
GO:0003700
GO:0006950
AF-A0A0M9ZY29-F1-model_v4 MarR family transcriptional regulator 0.9697 4 149 GO:0003700
GO:0006950
AF-A0A522BZK0-F1-model_v4 MarR family transcriptional regulator 0.9687 6 146 GO:0003700
GO:0006950
AF-A0A229TL59-F1-model_v4 MarR family transcriptional regulator 0.9676 6 150 GO:0003700
GO:0006950

Map