F212834

General Info

Members Datasets Scaffolds Average Seq Length
151 64 302 203

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_425492_c1|nmdc:mga09592_425492_c1_354_1049
Length 231
Sequence MGSNGKSNSGIFVETNPRFFRIMEYGARMIYTYQIEGITLQTGDLICTMNGKPDILPGEFWRFVGRLVPGDVDHVAIYTGPEGRCIEAGAYGVIKYTVFNGQWDTERMARRRGQLFDTFYGAVSPLDSLGLAEEEEHEMRKTIAAYCLGQVGKPYNLNFLNAETEESFYCSQLAYKAYQQIGIDLNTGLAMEQLPGTNAIIYPQEIWNGFSHRAADRTPLTNRQLLTSPSS

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
47 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
50 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
51 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
52 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
55 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
56 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
57 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
58 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
59 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
60 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
61 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
62 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
63 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
64 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 23.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_425492_c1 3300050508 Unclassified 1147
2 SwRhRL3b_contig_667117 2162886006 Bacteria 2475
3 JGI25406J46586_10007141 3300003203 Bacteria 5114
4 Ga0065704_10147303 3300005289 Bacteria 1460
5 Ga0065712_10207890 3300005290 Bacteria 1083
6 Ga0065707_10000508 3300005295 Bacteria 28121
7 Ga0065707_10003658 3300005295 Bacteria 5973
8 Ga0065707_10083604 3300005295 Bacteria 8648
9 Ga0065707_10088737 3300005295 Bacteria 4564
10 Ga0065707_10451562 3300005295 Unclassified 800
11 Ga0070703_10123372 3300005406 Bacteria 942
12 Ga0070705_100075215 3300005440 Bacteria 2056
13 Ga0070706_100046448 3300005467 Bacteria 4009
14 Ga0070707_100105924 3300005468 Bacteria 2727
15 Ga0070707_100278857 3300005468 Bacteria 1624
16 Ga0070698_100049639 3300005471 Unclassified 4281
17 Ga0070698_100158476 3300005471 Bacteria 2208
18 Ga0070698_100198119 3300005471 Bacteria 1944
19 Ga0070698_100334546 3300005471 Bacteria 1445
20 Ga0070699_100000765 3300005518 Bacteria 29681
21 Ga0070699_100021023 3300005518 Bacteria 5627
22 Ga0070699_100031706 3300005518 Bacteria 4563
23 Ga0070699_101109597 3300005518 Unclassified 726
24 Ga0070695_100803152 3300005545 Unclassified 754
25 Ga0070696_100099970 3300005546 Bacteria 2077
26 Ga0068859_100139138 3300005617 Bacteria 2501
27 Ga0068859_100211924 3300005617 Unclassified 2024
28 Ga0068860_100500594 3300005843 Bacteria 1213
29 Ga0068862_100003519 3300005844 Bacteria 13441
30 Ga0068862_100052018 3300005844 Unclassified 3504
31 Ga0081539_10003780 3300005985 Bacteria 17895
32 Ga0075428_100008657 3300006844 Bacteria 11287
33 Ga0075428_100152161 3300006844 Unclassified 2513
34 Ga0075428_100337049 3300006844 Bacteria 1620
35 Ga0075430_100130814 3300006846 Bacteria 2092
36 Ga0075430_100153942 3300006846 Bacteria 1914
37 Ga0075431_100135219 3300006847 Bacteria 2541
38 Ga0075433_10014638 3300006852 Bacteria 6414
39 Ga0075433_10257904 3300006852 Bacteria 1546
40 Ga0075429_100004833 3300006880 Bacteria 11608
41 Ga0075429_100014914 3300006880 Bacteria 6740
42 Ga0075429_100066254 3300006880 Bacteria 3144
43 Ga0075429_100113376 3300006880 Bacteria 2370
44 Ga0075429_100743726 3300006880 Unclassified 859
45 Ga0097620_100139131 3300006931 Bacteria 2501
46 Ga0097620_100211916 3300006931 Unclassified 2024
47 Ga0111539_10028020 3300009094 Bacteria 6879
48 Ga0114129_10004393 3300009147 Bacteria 19883
49 Ga0114129_10006821 3300009147 Bacteria 16219
50 Ga0114129_10063541 3300009147 Bacteria 5154
51 Ga0114129_10098970 3300009147 Bacteria 4036
52 Ga0114129_10102818 3300009147 Unclassified 3951
53 Ga0105243_10158449 3300009148 Bacteria 1949
54 Ga0105243_10425370 3300009148 Unclassified 1240
55 Ga0105241_10946317 3300009174 Unclassified 803
56 Ga0105249_10061053 3300009553 Bacteria 3459
57 Ga0207686_10189006 3300025934 Bacteria 1467
58 Ga0207709_10081954 3300025935 Bacteria 2082
59 Ga0207712_10140986 3300025961 Unclassified 1850
60 Ga0268265_10048811 3300028380 Unclassified 3180
61 Ga0268265_10157827 3300028380 Bacteria 1922
62 Ga0268265_10282523 3300028380 Bacteria 1486
63 Ga0316579_10026917 3300031691 Unclassified 2607
64 Ga0316579_10047746 3300031691 Bacteria 1999
65 Ga0316578_10081595 3300031728 Bacteria 1924
66 Ga0316578_10224804 3300031728 Bacteria 1128
67 Ga0316577_10035430 3300031733 Unclassified 2789
68 Ga0316577_10079166 3300031733 Bacteria 1836
69 Ga0307413_10305908 3300031824 Unclassified 1208
70 Ga0307407_10031464 3300031903 Unclassified 2874
71 Ga0307409_100203134 3300031995 Unclassified 1775
72 Ga0307411_10247860 3300032005 Bacteria 1399
73 Ga0316582_0008676 3300036647 Bacteria 5471
74 Ga0316584_0032605 3300036712 Bacteria 3856
75 Ga0316584_0140388 3300036712 Bacteria 1802
76 Ga0316584_0153615 3300036712 Bacteria 1713
77 Ga0451577_0006946 3300042876 Bacteria 11184
78 Ga0451577_0029314 3300042876 Unclassified 4974
79 Ga0451577_0095562 3300042876 Bacteria 2653
80 Ga0451577_0203128 3300042876 Bacteria 1789
81 Ga0451577_0446446 3300042876 Bacteria 1174
82 Ga0453683_0007784 3300044673 Bacteria 7246
83 Ga0453683_0019310 3300044673 Bacteria 4367
84 Ga0453683_0093184 3300044673 Bacteria 1889
85 Ga0453683_0099922 3300044673 Viruses 1821
86 Ga0453683_0456572 3300044673 Unclassified 827
87 Ga0453684_0000003 3300044712 Bacteria 1481694
88 Ga0453684_0002474 3300044712 Bacteria 44668
89 Ga0453684_0002901 3300044712 Bacteria 40182
90 Ga0453684_0006959 3300044712 Bacteria 21165
91 Ga0453684_0029787 3300044712 Bacteria 7735
92 Ga0453684_0033129 3300044712 Bacteria 7209
93 Ga0453684_0080195 3300044712 Bacteria 4076
94 Ga0453684_0103761 3300044712 Bacteria 3473
95 Ga0453684_0308559 3300044712 Bacteria 1796
96 Ga0453684_0330524 3300044712 Unclassified 1724
97 Ga0453684_0427012 3300044712 Bacteria 1479
98 Ga0453684_0430601 3300044712 Bacteria 1472
99 Ga0453684_0491253 3300044712 Bacteria 1360
100 Ga0453684_0522297 3300044712 Bacteria 1311
101 Ga0453684_0533216 3300044712 Bacteria 1295
102 Ga0453684_0561037 3300044712 Bacteria 1257
103 Ga0453684_0563882 3300044712 Unclassified 1253
104 Ga0453684_0747514 3300044712 Unclassified 1059
105 Ga0453684_0792100 3300044712 Bacteria 1023
106 Ga0453684_0856388 3300044712 Bacteria 976
107 Ga0453684_1546179 3300044712 Unclassified 683
108 Ga0451576_0000046 3300045051 Bacteria 334064
109 Ga0451576_0008776 3300045051 Bacteria 11825
110 Ga0451576_0061442 3300045051 Unclassified 3917
111 Ga0451576_0257972 3300045051 Bacteria 1822
112 Ga0451576_0272906 3300045051 Bacteria 1768
113 Ga0451576_0451202 3300045051 Unclassified 1350
114 Ga0451576_0529232 3300045051 Unclassified 1238
115 Ga0501039_0140962 3300049575 Bacteria 1894
116 Ga0501048_0830370 3300049582 Bacteria 664
117 Ga0501071_0134042 3300049587 Unclassified 1842
118 Ga0501072_0199188 3300049588 Bacteria 1597
119 Ga0501072_0350080 3300049588 Bacteria 1173
120 Ga0501074_0388673 3300049590 Bacteria 990
121 Ga0501075_0002677 3300049591 Bacteria 11903
122 Ga0501075_0364582 3300049591 Bacteria 1101
123 Ga0501076_0016371 3300049592 Bacteria 5623
124 Ga0501076_0047806 3300049592 Unclassified 3383
125 Ga0501076_0630665 3300049592 Unclassified 884
126 Ga0501079_0025535 3300049741 Bacteria 4530
127 Ga0501079_0046907 3300049741 Bacteria 3334
128 Ga0501080_0048317 3300049742 Bacteria 3961
129 Ga0501080_0239100 3300049742 Bacteria 1658
130 Ga0501081_0043192 3300049743 Bacteria 3091
131 Ga0501081_0057560 3300049743 Unclassified 2688
132 nmdc:mga05p37_114241_c1 3300050507 Bacteria 3319
133 nmdc:mga05p37_15587_c1 3300050507 Bacteria 9134
134 nmdc:mga05p37_172552_c1 3300050507 Bacteria 2637
135 nmdc:mga05p37_476110_c1 3300050507 Bacteria 1439
136 nmdc:mga05p37_5206_c1 3300050507 Bacteria 15263
137 nmdc:mga05p37_87541_c1 3300050507 Bacteria 3839
138 nmdc:mga09592_163300_c1 3300050508 Bacteria 1924
139 nmdc:mga09592_1986_c1 3300050508 Bacteria 16501
140 nmdc:mga09592_24304_c1 3300050508 Bacteria 5010
141 nmdc:mga09592_8247_c1 3300050508 Bacteria 8473
142 nmdc:mga09592_85369_c1 3300050508 Bacteria 2693
143 nmdc:mga09592_96463_c1 3300050508 Bacteria 2529
144 nmdc:mga0qj67_698177_c1 3300050509 Unclassified 807
145 nmdc:mga06r32_157626_c1 3300050510 Bacteria 2252
146 nmdc:mga08y16_305924_c1 3300050511 Bacteria 1638
147 nmdc:mga0a205_111443_c1 3300050515 Bacteria 2635
148 Ga0501084_0037162 3300054114 Bacteria 4069
149 Ga0501084_0716296 3300054114 Unclassified 844
150 Ga0501082_0398924 3300060353 Bacteria 1200
151 Ga0530510_0399354 3300061734 Bacteria 1036
152 nmdc:mga09592_425492_c1
153 SwRhRL3b_contig_667117
154 JGI25406J46586_10007141
155 Ga0065704_10147303
156 Ga0065712_10207890
157 Ga0065707_10000508
158 Ga0065707_10003658
159 Ga0065707_10083604
160 Ga0065707_10088737
161 Ga0065707_10451562
162 Ga0070703_10123372
163 Ga0070705_100075215
164 Ga0070706_100046448
165 Ga0070707_100105924
166 Ga0070707_100278857
167 Ga0070698_100049639
168 Ga0070698_100158476
169 Ga0070698_100198119
170 Ga0070698_100334546
171 Ga0070699_100000765
172 Ga0070699_100021023
173 Ga0070699_100031706
174 Ga0070699_101109597
175 Ga0070695_100803152
176 Ga0070696_100099970
177 Ga0068859_100139138
178 Ga0068859_100211924
179 Ga0068860_100500594
180 Ga0068862_100003519
181 Ga0068862_100052018
182 Ga0081539_10003780
183 Ga0075428_100008657
184 Ga0075428_100152161
185 Ga0075428_100337049
186 Ga0075430_100130814
187 Ga0075430_100153942
188 Ga0075431_100135219
189 Ga0075433_10014638
190 Ga0075433_10257904
191 Ga0075429_100004833
192 Ga0075429_100014914
193 Ga0075429_100066254
194 Ga0075429_100113376
195 Ga0075429_100743726
196 Ga0097620_100139131
197 Ga0097620_100211916
198 Ga0111539_10028020
199 Ga0114129_10004393
200 Ga0114129_10006821
201 Ga0114129_10063541
202 Ga0114129_10098970
203 Ga0114129_10102818
204 Ga0105243_10158449
205 Ga0105243_10425370
206 Ga0105241_10946317
207 Ga0105249_10061053
208 Ga0207686_10189006
209 Ga0207709_10081954
210 Ga0207712_10140986
211 Ga0268265_10048811
212 Ga0268265_10157827
213 Ga0268265_10282523
214 Ga0316579_10026917
215 Ga0316579_10047746
216 Ga0316578_10081595
217 Ga0316578_10224804
218 Ga0316577_10035430
219 Ga0316577_10079166
220 Ga0307413_10305908
221 Ga0307407_10031464
222 Ga0307409_100203134
223 Ga0307411_10247860
224 Ga0316582_0008676
225 Ga0316584_0032605
226 Ga0316584_0140388
227 Ga0316584_0153615
228 Ga0451577_0006946
229 Ga0451577_0029314
230 Ga0451577_0095562
231 Ga0451577_0203128
232 Ga0451577_0446446
233 Ga0453683_0007784
234 Ga0453683_0019310
235 Ga0453683_0093184
236 Ga0453683_0099922
237 Ga0453683_0456572
238 Ga0453684_0000003
239 Ga0453684_0002474
240 Ga0453684_0002901
241 Ga0453684_0006959
242 Ga0453684_0029787
243 Ga0453684_0033129
244 Ga0453684_0080195
245 Ga0453684_0103761
246 Ga0453684_0308559
247 Ga0453684_0330524
248 Ga0453684_0427012
249 Ga0453684_0430601
250 Ga0453684_0491253
251 Ga0453684_0522297
252 Ga0453684_0533216
253 Ga0453684_0561037
254 Ga0453684_0563882
255 Ga0453684_0747514
256 Ga0453684_0792100
257 Ga0453684_0856388
258 Ga0453684_1546179
259 Ga0451576_0000046
260 Ga0451576_0008776
261 Ga0451576_0061442
262 Ga0451576_0257972
263 Ga0451576_0272906
264 Ga0451576_0451202
265 Ga0451576_0529232
266 Ga0501039_0140962
267 Ga0501048_0830370
268 Ga0501071_0134042
269 Ga0501072_0199188
270 Ga0501072_0350080
271 Ga0501074_0388673
272 Ga0501075_0002677
273 Ga0501075_0364582
274 Ga0501076_0016371
275 Ga0501076_0047806
276 Ga0501076_0630665
277 Ga0501079_0025535
278 Ga0501079_0046907
279 Ga0501080_0048317
280 Ga0501080_0239100
281 Ga0501081_0043192
282 Ga0501081_0057560
283 nmdc:mga05p37_114241_c1
284 nmdc:mga05p37_15587_c1
285 nmdc:mga05p37_172552_c1
286 nmdc:mga05p37_476110_c1
287 nmdc:mga05p37_5206_c1
288 nmdc:mga05p37_87541_c1
289 nmdc:mga09592_163300_c1
290 nmdc:mga09592_1986_c1
291 nmdc:mga09592_24304_c1
292 nmdc:mga09592_8247_c1
293 nmdc:mga09592_85369_c1
294 nmdc:mga09592_96463_c1
295 nmdc:mga0qj67_698177_c1
296 nmdc:mga06r32_157626_c1
297 nmdc:mga08y16_305924_c1
298 nmdc:mga0a205_111443_c1
299 Ga0501084_0037162
300 Ga0501084_0716296
301 Ga0501082_0398924
302 Ga0530510_0399354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05708

Peptidase_C92

Permuted papain-like amidase enzyme, YaeF/YiiX, C92 family

40

208

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ah0-assembly1.cif.gz_W the cryo-em structure of the precusor of human pre-catalytic spliceosome (pre-b complex) 0.5851 17 68
5c6r-assembly1.cif.gz_A crystal structure of ph domain of asap1 0.4847 18 69
7zh4-assembly1.cif.gz_D usp1 bound to ml323 and ubiquitin conjugated to fancd2 (focused refinement) 0.4733 17 92
7ytu-assembly1.cif.gz_A crystal structure of vaccinia virus g3/l5 sub-complex (semet-labeled, p31 space group) 0.4712 17 69
4r0k-assembly1.cif.gz_A crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution 0.463 3 90
ID Description Score Start End Superfamily
af_Q9ZVT1_72_152_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.5717 42 70 2.30.30.140
af_Q8IJT5_23_144_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5107 16 69 2.30.29.30
3h6sH00 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.5066 38 70 2.80.10.50
af_Q17361_96_463_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.4927 17 92 3.90.70.10
af_Q2G270_13_104_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.4648 16 72 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7Y5BUY2-F1-model_v4 Permuted papain-like amidase enzyme, YaeF/YiiX, C92 family 0.7731 1 185
AF-A0A1G0LTU3-F1-model_v4 Uncharacterized protein 0.7676 1 184
AF-A0A1G1F1X1-F1-model_v4 Uncharacterized protein 0.7665 1 188
AF-A0A3D3UTA6-F1-model_v4 Uncharacterized protein 0.7658 1 187
AF-A0A3M9YZU3-F1-model_v4 YiiX family permuted papain-like enzyme 0.7606 1 188

Map