F213816

General Info

Members Datasets Scaffolds Average Seq Length
152 116 304 273

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100382244|Ga0068855_1003822442
Length 290
Sequence LAELFDQHGPSDPHDRYGSDVLADARAANAARAIPTVDAHPGEVLELPDGFVGAVTRLEKGTVELEDRHGARRVFPLGPGFLVDGKPVVVRAPTAAAPRPGQVRTASGSIAQTSPGEPQRARVARAHRIFVEGRHDGELVEKIWGPDLRAEGIVVEYLDGIDHLDETLRAVQPGPERRIGVLVDHLVPGSKESRIAEQVTSPHVLVVGHPFIDVWQGVKPSRLGLSAWPVIARGTEWKHGVCAALGWPHDDQTDIAAAWQRILGSVRDYHDLEPALLGRVEQLIDFTSTP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
103 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
104 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
105 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
106 2643221566 Microbacterium sp. Root166 Isolate Unclassified
107 2643221597 Microbacterium sp. Root180 Isolate Unclassified
108 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
109 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
110 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
111 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
112 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
113 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
114 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
115 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
116 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 7.24
Rhizosphere 73.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100382244 3300005563 Bacteria 1546
2 Ga0070658_10007925 3300005327 Bacteria 8552
3 Ga0070658_10173222 3300005327 Bacteria 1813
4 Ga0070666_10105077 3300005335 Bacteria 1950
5 Ga0068868_100201318 3300005338 Bacteria 1660
6 Ga0070660_100014578 3300005339 Bacteria 5669
7 Ga0070659_100000149 3300005366 Bacteria 53509
8 Ga0070667_100015030 3300005367 Bacteria 6395
9 Ga0070714_100217931 3300005435 Bacteria 1753
10 Ga0068853_100034953 3300005539 Bacteria 4267
11 Ga0068853_100083148 3300005539 Bacteria 2804
12 Ga0070672_100030545 3300005543 Bacteria 4049
13 Ga0070665_100078265 3300005548 Bacteria 3313
14 Ga0068855_100005174 3300005563 Bacteria 15907
15 Ga0068855_100027328 3300005563 Bacteria 6826
16 Ga0068855_100261765 3300005563 Bacteria 1926
17 Ga0068855_100261766 3300005563 Bacteria 1926
18 Ga0068857_100160525 3300005577 Bacteria 2040
19 Ga0068856_100015493 3300005614 Bacteria 7368
20 Ga0068856_100142248 3300005614 Bacteria 2406
21 Ga0068852_100007241 3300005616 Bacteria 8092
22 Ga0068852_100045478 3300005616 Bacteria 3734
23 Ga0068864_100033064 3300005618 Bacteria 4396
24 Ga0068851_10000014 3300005834 Bacteria 151675
25 Ga0068863_100057657 3300005841 Bacteria 3675
26 Ga0068858_100000276 3300005842 Bacteria 55258
27 Ga0075365_10008356 3300006038 Bacteria 5869
28 Ga0075365_10088910 3300006038 Bacteria 2102
29 Ga0105240_10002898 3300009093 Bacteria 27065
30 Ga0105240_10823419 3300009093 Bacteria 1004
31 Ga0105245_10023393 3300009098 Bacteria 5423
32 Ga0105247_10009201 3300009101 Bacteria 6008
33 Ga0105243_10042762 3300009148 Bacteria 3548
34 Ga0105241_10003266 3300009174 Bacteria 12064
35 Ga0105248_10000681 3300009177 Bacteria 38440
36 Ga0105248_10193754 3300009177 Bacteria 2290
37 Ga0105237_10016997 3300009545 Bacteria 7549
38 Ga0105237_10336753 3300009545 Bacteria 1513
39 Ga0105238_10032429 3300009551 Bacteria 5316
40 Ga0105238_10075761 3300009551 Bacteria 3356
41 Ga0105239_10062592 3300010375 Bacteria 4084
42 Ga0105239_10437305 3300010375 Bacteria 1483
43 Ga0105239_10893789 3300010375 Bacteria 1019
44 Ga0171462_1001 3300013250 Bacteria 1135406
45 Ga0163163_10227033 3300014325 Bacteria 1916
46 Ga0157379_10008422 3300014968 Bacteria 8964
47 Ga0207656_10000002 3300025321 Bacteria 792178
48 Ga0207655_1009321 3300025728 Bacteria 6110
49 Ga0207705_10180493 3300025909 Bacteria 1593
50 Ga0207654_10000001 3300025911 Bacteria 1816198
51 Ga0207695_10002117 3300025913 Bacteria 30146
52 Ga0207695_10009994 3300025913 Bacteria 11655
53 Ga0207671_10000002 3300025914 Bacteria 1144816
54 Ga0207657_10004316 3300025919 Bacteria 15066
55 Ga0207694_10000274 3300025924 Bacteria 48845
56 Ga0207694_10046649 3300025924 Bacteria 3349
57 Ga0207687_10073997 3300025927 Bacteria 2441
58 Ga0207687_10107625 3300025927 Bacteria 2063
59 Ga0207700_10018485 3300025928 Bacteria 4685
60 Ga0207690_10001692 3300025932 Bacteria 13602
61 Ga0207709_10023134 3300025935 Bacteria 3533
62 Ga0207691_10045133 3300025940 Bacteria 4052
63 Ga0207711_10007361 3300025941 Bacteria 9212
64 Ga0207711_10111125 3300025941 Bacteria 2437
65 Ga0207667_10000272 3300025949 Bacteria 71730
66 Ga0207667_10001177 3300025949 Bacteria 32862
67 Ga0207667_10208414 3300025949 Bacteria 2004
68 Ga0207667_10339658 3300025949 Bacteria 1533
69 Ga0207658_10029079 3300025986 Bacteria 3898
70 Ga0207677_10209376 3300026023 Bacteria 1556
71 Ga0207703_10000141 3300026035 Bacteria 86068
72 Ga0207639_10005098 3300026041 Bacteria 8855
73 Ga0207639_10022965 3300026041 Bacteria 4499
74 Ga0207702_10034095 3300026078 Bacteria 4254
75 Ga0207702_10106435 3300026078 Bacteria 2485
76 Ga0207641_10028355 3300026088 Bacteria 4626
77 Ga0207674_10015557 3300026116 Bacteria 8355
78 Ga0207674_10426479 3300026116 Bacteria 1281
79 Ga0207698_10002260 3300026142 Bacteria 11394
80 Ga0207698_10014974 3300026142 Bacteria 5176
81 Ga0307405_10289612 3300031731 Bacteria 1237
82 Ga0307410_10205372 3300031852 Bacteria 1507
83 Ga0307406_10028175 3300031901 Bacteria 3392
84 Ga0451793_0123529 3300041452 Bacteria 1648
85 Ga0451806_062005 3300041462 Bacteria 2910
86 Ga0439462_0020196 3300042015 Bacteria 1736
87 Ga0450918_033826 3300042531 Bacteria 907
88 Ga0466965_0000009 3300044683 Bacteria 122488
89 Ga0466968_0009883 3300044735 Bacteria 3683
90 Ga0495650_0001402 3300046471 Bacteria 23574
91 Ga0495686_0140942 3300047472 Bacteria 1423
92 Ga0496104_0315819 3300048907 Bacteria 1475
93 Ga0496105_0182221 3300048908 Bacteria 1719
94 Ga0496105_0287301 3300048908 Bacteria 1325
95 Ga0496110_0039259 3300048913 Bacteria 4122
96 Ga0496110_0127251 3300048913 Bacteria 2299
97 Ga0496111_0563752 3300048914 Bacteria 835
98 Ga0496113_0244825 3300048916 Bacteria 1431
99 Ga0496114_0019580 3300048917 Bacteria 5484
100 Ga0496115_0154898 3300048918 Bacteria 1893
101 Ga0496117_0000028 3300048920 Bacteria 407392
102 Ga0496119_0001517 3300048922 Bacteria 27747
103 Ga0496119_0001615 3300048922 Bacteria 26709
104 Ga0496120_0000426 3300048923 Bacteria 66901
105 Ga0496120_0001547 3300048923 Bacteria 26928
106 Ga0496121_0000891 3300048924 Bacteria 53863
107 Ga0496122_0093312 3300048925 Bacteria 2042
108 Ga0496124_0006853 3300048927 Bacteria 12269
109 Ga0496125_0008113 3300048928 Bacteria 11060
110 Ga0496126_0012176 3300048929 Bacteria 8828
111 Ga0501031_0359137 3300049568 Bacteria 943
112 Ga0501032_0015771 3300049569 Bacteria 5328
113 Ga0501033_0014847 3300049570 Bacteria 5913
114 Ga0501034_0038353 3300049571 Bacteria 4851
115 Ga0501034_0288376 3300049571 Bacteria 1580
116 Ga0501036_0347288 3300049572 Bacteria 1239
117 Ga0501037_0009764 3300049573 Bacteria 7047
118 Ga0501038_0038599 3300049574 Bacteria 4181
119 Ga0501039_0083947 3300049575 Bacteria 2481
120 Ga0501043_0052146 3300049579 Bacteria 3214
121 Ga0501043_0179290 3300049579 Bacteria 1651
122 Ga0501047_0007683 3300049581 Bacteria 10157
123 Ga0501047_0088461 3300049581 Bacteria 2974
124 Ga0501070_0036429 3300049586 Bacteria 4108
125 Ga0501073_0017075 3300049589 Bacteria 5257
126 Ga0501035_0004104 3300049822 Bacteria 13845
127 Ga0501035_0290099 3300049822 Bacteria 1381
128 Ga0501044_0001106 3300049823 Bacteria 32051
129 Ga0501044_0015621 3300049823 Bacteria 8178
130 Ga0501044_0250404 3300049823 Bacteria 1713
131 nmdc:mga03n38_14767_c1 3300050490 Bacteria 3002
132 nmdc:mga00v17_76584_c1 3300050491 Bacteria 2081
133 nmdc:mga0yw44_66232_c1 3300050492 Bacteria 2229
134 nmdc:mga06z11_5323_c1 3300050494 Bacteria 5156
135 nmdc:mga0sz30_56241_c1 3300050516 Bacteria 1675
136 Ga0500635_0060241 3300053080 Bacteria 1323
137 Ga0500651_0000368 3300053093 Bacteria 24842
138 Ga0500568_0000304 3300053139 Bacteria 39367
139 Ga0500588_0001965 3300053146 Bacteria 4062
140 Ga0500620_000032 3300053155 Bacteria 27722
141 2588106700 2585428157 Bacteria 3018951
142 2643849420 2643221566 Bacteria 3460379
143 2643996400 2643221597 Bacteria 3347721
144 2774400204 2773857763 Bacteria 4180068
145 2808631700 2808606306 Bacteria 3608896
146 2808885087 2808606368 Bacteria 3174172
147 2821269408 2821268502 Bacteria 3750023
148 2852633091 2852632344 Bacteria 3463163
149 2852645863 2852643534 Bacteria 3013378
150 2857738733 2857737099 Bacteria 3104305
151 2870629773 2870628048 Bacteria 3696012
152 8045832676 8045830549 Bacteria 4444727
153 Ga0068855_100382244
154 Ga0070658_10007925
155 Ga0070658_10173222
156 Ga0070666_10105077
157 Ga0068868_100201318
158 Ga0070660_100014578
159 Ga0070659_100000149
160 Ga0070667_100015030
161 Ga0070714_100217931
162 Ga0068853_100034953
163 Ga0068853_100083148
164 Ga0070672_100030545
165 Ga0070665_100078265
166 Ga0068855_100005174
167 Ga0068855_100027328
168 Ga0068855_100261765
169 Ga0068855_100261766
170 Ga0068857_100160525
171 Ga0068856_100015493
172 Ga0068856_100142248
173 Ga0068852_100007241
174 Ga0068852_100045478
175 Ga0068864_100033064
176 Ga0068851_10000014
177 Ga0068863_100057657
178 Ga0068858_100000276
179 Ga0075365_10008356
180 Ga0075365_10088910
181 Ga0105240_10002898
182 Ga0105240_10823419
183 Ga0105245_10023393
184 Ga0105247_10009201
185 Ga0105243_10042762
186 Ga0105241_10003266
187 Ga0105248_10000681
188 Ga0105248_10193754
189 Ga0105237_10016997
190 Ga0105237_10336753
191 Ga0105238_10032429
192 Ga0105238_10075761
193 Ga0105239_10062592
194 Ga0105239_10437305
195 Ga0105239_10893789
196 Ga0171462_1001
197 Ga0163163_10227033
198 Ga0157379_10008422
199 Ga0207656_10000002
200 Ga0207655_1009321
201 Ga0207705_10180493
202 Ga0207654_10000001
203 Ga0207695_10002117
204 Ga0207695_10009994
205 Ga0207671_10000002
206 Ga0207657_10004316
207 Ga0207694_10000274
208 Ga0207694_10046649
209 Ga0207687_10073997
210 Ga0207687_10107625
211 Ga0207700_10018485
212 Ga0207690_10001692
213 Ga0207709_10023134
214 Ga0207691_10045133
215 Ga0207711_10007361
216 Ga0207711_10111125
217 Ga0207667_10000272
218 Ga0207667_10001177
219 Ga0207667_10208414
220 Ga0207667_10339658
221 Ga0207658_10029079
222 Ga0207677_10209376
223 Ga0207703_10000141
224 Ga0207639_10005098
225 Ga0207639_10022965
226 Ga0207702_10034095
227 Ga0207702_10106435
228 Ga0207641_10028355
229 Ga0207674_10015557
230 Ga0207674_10426479
231 Ga0207698_10002260
232 Ga0207698_10014974
233 Ga0307405_10289612
234 Ga0307410_10205372
235 Ga0307406_10028175
236 Ga0451793_0123529
237 Ga0451806_062005
238 Ga0439462_0020196
239 Ga0450918_033826
240 Ga0466965_0000009
241 Ga0466968_0009883
242 Ga0495650_0001402
243 Ga0495686_0140942
244 Ga0496104_0315819
245 Ga0496105_0182221
246 Ga0496105_0287301
247 Ga0496110_0039259
248 Ga0496110_0127251
249 Ga0496111_0563752
250 Ga0496113_0244825
251 Ga0496114_0019580
252 Ga0496115_0154898
253 Ga0496117_0000028
254 Ga0496119_0001517
255 Ga0496119_0001615
256 Ga0496120_0000426
257 Ga0496120_0001547
258 Ga0496121_0000891
259 Ga0496122_0093312
260 Ga0496124_0006853
261 Ga0496125_0008113
262 Ga0496126_0012176
263 Ga0501031_0359137
264 Ga0501032_0015771
265 Ga0501033_0014847
266 Ga0501034_0038353
267 Ga0501034_0288376
268 Ga0501036_0347288
269 Ga0501037_0009764
270 Ga0501038_0038599
271 Ga0501039_0083947
272 Ga0501043_0052146
273 Ga0501043_0179290
274 Ga0501047_0007683
275 Ga0501047_0088461
276 Ga0501070_0036429
277 Ga0501073_0017075
278 Ga0501035_0004104
279 Ga0501035_0290099
280 Ga0501044_0001106
281 Ga0501044_0015621
282 Ga0501044_0250404
283 nmdc:mga03n38_14767_c1
284 nmdc:mga00v17_76584_c1
285 nmdc:mga0yw44_66232_c1
286 nmdc:mga06z11_5323_c1
287 nmdc:mga0sz30_56241_c1
288 Ga0500635_0060241
289 Ga0500651_0000368
290 Ga0500568_0000304
291 Ga0500588_0001965
292 Ga0500620_000032
293 2588106700
294 2643849420
295 2643996400
296 2774400204
297 2808631700
298 2808885087
299 2821269408
300 2852633091
301 2852645863
302 2857738733
303 2870629773
304 8045832676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11296

DUF3097_C

DUF3097, C-terminal domain

127

289

0.98

PF22845

DUF3097_N

DUF3097, N-terminal domain

36

93

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hw9-assembly1.cif.gz_E crystal structure of helicobacter pylori mscs (closed state) 0.8098 31 67
8tdm-assembly1.cif.gz_A cryo-em structure of atmsl10-k539e 0.8071 32 67
8tdj-assembly1.cif.gz_B cryo-em structure of the wild-type atmsl10 in gdn 0.803 32 67
7egt-assembly2.cif.gz_B the crystal structure of the c-terminal domain of t. thermophilus uvrd complexed with the n-terminal domain of uvrb 0.7941 31 67
7dhw-assembly1.cif.gz_A crystal structure of myosin-xi motor domain in complex with adp-alf4 0.7928 33 67
ID Description Score Start End Superfamily
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8811 44 67 3.30.920.30
af_P75783_574_621_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8699 31 67 2.30.30.60
af_P77338_945_994_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.859 31 67 2.30.30.60
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8473 31 67 2.30.30.60
af_O13936_472_519_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8422 31 67 2.30.30.30
ID Description Score Start End GO Terms
AF-E7NC91-F1-model_v4 DUF3097 domain-containing protein 0.9582 114 282
AF-A0A4Q3IQT2-F1-model_v4 deleted 0.9463 127 281
AF-A0A6J6IBJ3-F1-model_v4 Unannotated protein 0.9456 110 282
AF-A0A4Q3IQT2-F1-model_v4 deleted 0.9403 127 281
AF-A0A652K0G9-F1-model_v4 DUF3097 family protein 0.937 99 282

Map