F213839

General Info

Members Datasets Scaffolds Average Seq Length
152 140 304 88

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100739191|Ga0068856_1007391911
Length 108
Sequence MPVQKDRDDLWWMALAWEDYRYWQQHNPDNAVAINELIEEIRKDPWKGKGKPEPLKGNLTGWWSRRITIADRLVYRLFDLPKPRKGQVKPEMATAIQIAQCRYHYGSK

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
114 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
115 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
124 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
125 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
126 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2512875024
136 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
137 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
138 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
139 2818991435 Caulobacter henricii 536 Isolate Unclassified
140 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.13
Nodule 1.32
Rhizoplane 0.66
Rhizosphere 71.05
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100739191 3300005614 Unclassified 1004
2 rootL2_10301230 3300003322 Bacteria 1230
3 Ga0055537_1007274 3300003773 Bacteria 2689
4 Ga0055528_1003962 3300003790 Bacteria 7252
5 Ga0065165_1000561 3300005262 Bacteria 55325
6 Ga0065704_10155313 3300005289 Bacteria 1396
7 Ga0065707_10211876 3300005295 Bacteria 1262
8 Ga0070658_10803288 3300005327 Bacteria 817
9 Ga0070680_101290485 3300005336 Unclassified 632
10 Ga0070691_10040220 3300005341 Bacteria 2210
11 Ga0070668_100000488 3300005347 Bacteria 26299
12 Ga0070667_100050574 3300005367 Bacteria 3503
13 Ga0070714_100978281 3300005435 Bacteria 823
14 Ga0070681_10070539 3300005458 Bacteria 3459
15 Ga0068867_102200815 3300005459 Unclassified 523
16 Ga0070699_100755545 3300005518 Bacteria 889
17 Ga0070679_100006088 3300005530 Bacteria 11223
18 Ga0068853_100071973 3300005539 Bacteria 3012
19 Ga0070672_101728542 3300005543 Unclassified 562
20 Ga0070665_100008223 3300005548 Bacteria 10561
21 Ga0068855_100331638 3300005563 Bacteria 1679
22 Ga0068855_100703731 3300005563 Unclassified 1081
23 Ga0068857_100867348 3300005577 Unclassified 864
24 Ga0068856_100006671 3300005614 Bacteria 11313
25 Ga0068852_101314711 3300005616 Bacteria 745
26 Ga0068859_100565127 3300005617 Bacteria 1231
27 Ga0068851_10399783 3300005834 Bacteria 808
28 Ga0068863_100015742 3300005841 Bacteria 7263
29 Ga0068860_100190538 3300005843 Bacteria 1984
30 Ga0068862_100000198 3300005844 Bacteria 66534
31 Ga0081539_10028156 3300005985 Bacteria 3539
32 Ga0075366_10341031 3300006195 Bacteria 919
33 Ga0097620_100565098 3300006931 Bacteria 1231
34 Ga0079104_1023512 3300006946 Bacteria 1638
35 Ga0105240_10069186 3300009093 Bacteria 4370
36 Ga0105240_10474552 3300009093 Bacteria 1395
37 Ga0105240_10941761 3300009093 Bacteria 927
38 Ga0105247_10036253 3300009101 Bacteria 3007
39 Ga0105242_10327777 3300009176 Unclassified 1407
40 Ga0105237_12675698 3300009545 Bacteria 510
41 Ga0105238_10732164 3300009551 Bacteria 1002
42 Ga0105249_10000015 3300009553 Bacteria 282138
43 Ga0105239_11043083 3300010375 Bacteria 940
44 Ga0157373_10071915 3300013100 Bacteria 2442
45 Ga0157373_11103906 3300013100 Unclassified 595
46 Ga0157369_10010979 3300013105 Bacteria 10309
47 Ga0171462_1049 3300013250 Bacteria 41263
48 Ga0157380_10645606 3300014326 Bacteria 1055
49 Ga0157379_10240771 3300014968 Unclassified 1641
50 Ga0213873_10246753 3300021358 Bacteria 565
51 Ga0213876_10179750 3300021384 Unclassified 1125
52 Ga0213875_10140829 3300021388 Bacteria 1129
53 Ga0209565_1000451 3300025263 Bacteria 31880
54 Ga0209673_1004519 3300025273 Bacteria 7407
55 Ga0209564_1001987 3300025295 Bacteria 17899
56 Ga0209564_1089337 3300025295 Bacteria 570
57 Ga0209256_1011268 3300025299 Bacteria 3602
58 Ga0209257_1000352 3300025304 Bacteria 94530
59 Ga0207710_10011802 3300025900 Bacteria 3674
60 Ga0207705_10270586 3300025909 Bacteria 1299
61 Ga0207707_10319337 3300025912 Bacteria 1341
62 Ga0207695_10000321 3300025913 Bacteria 116087
63 Ga0207657_10051717 3300025919 Bacteria 3570
64 Ga0207652_10140830 3300025921 Bacteria 2156
65 Ga0207694_10783164 3300025924 Bacteria 805
66 Ga0207664_11657850 3300025929 Unclassified 562
67 Ga0207711_10060073 3300025941 Unclassified 3275
68 Ga0207661_11162553 3300025944 Bacteria 710
69 Ga0207667_10668254 3300025949 Bacteria 1043
70 Ga0207667_11352476 3300025949 Unclassified 687
71 Ga0207712_10000023 3300025961 Bacteria 282081
72 Ga0207668_10000438 3300025972 Bacteria 26296
73 Ga0207658_10360405 3300025986 Bacteria 1268
74 Ga0207703_11287824 3300026035 Bacteria 703
75 Ga0207639_10338177 3300026041 Bacteria 1341
76 Ga0207702_10208816 3300026078 Bacteria 1814
77 Ga0207702_10592115 3300026078 Unclassified 1088
78 Ga0207641_10003216 3300026088 Bacteria 14612
79 Ga0207674_11473235 3300026116 Bacteria 650
80 Ga0207698_10302291 3300026142 Bacteria 1490
81 Ga0207698_11801590 3300026142 Bacteria 627
82 Ga0268266_10366054 3300028379 Bacteria 1357
83 Ga0268265_10000021 3300028380 Bacteria 272292
84 Ga0268264_10000682 3300028381 Bacteria 39550
85 Ga0307517_10093703 3300028786 Bacteria 2432
86 Ga0265324_10036141 3300029957 Bacteria 1718
87 Ga0265328_10305994 3300031239 Bacteria 614
88 Ga0307408_100119024 3300031548 Bacteria 2043
89 Ga0265342_10549568 3300031712 Bacteria 586
90 Ga0307516_10000004 3300031730 Bacteria 367451
91 Ga0307510_10132518 3300033180 Bacteria 2160
92 Ga0395898_0766346 3300037466 Bacteria 906
93 Ga0395905_0002474 3300037471 Bacteria 20465
94 Ga0436364_0703484 3300037853 Bacteria 2146
95 Ga0395901_1892122 3300038443 Bacteria 544
96 Ga0400483_066682 3300039062 Bacteria 2040
97 Ga0436365_0466878 3300039437 Bacteria 5942
98 Ga0436365_0945319 3300039437 Unclassified 1360
99 Ga0436360_0713559 3300039438 Bacteria 571
100 Ga0436362_0106782 3300039453 Bacteria 951
101 Ga0466967_1492639 3300045976 Unclassified 673
102 Ga0495638_0006685 3300046460 Bacteria 8357
103 Ga0495616_0253504 3300046513 Bacteria 755
104 Ga0495620_0027414 3300046515 Bacteria 2666
105 Ga0495648_0141358 3300046524 Bacteria 1266
106 Ga0495642_0025899 3300046528 Bacteria 2327
107 Ga0495654_0000016 3300046530 Bacteria 306416
108 Ga0495625_0033971 3300046660 Bacteria 3766
109 Ga0495669_0000024 3300046684 Bacteria 113943
110 Ga0495660_0034798 3300046810 Bacteria 2817
111 Ga0495677_0023417 3300047445 Bacteria 2242
112 Ga0495686_0101758 3300047472 Bacteria 1732
113 Ga0496119_0030869 3300048922 Bacteria 3604
114 Ga0496119_0118081 3300048922 Bacteria 1462
115 Ga0496120_0236531 3300048923 Bacteria 864
116 Ga0496121_0070995 3300048924 Bacteria 2802
117 Ga0496124_0530577 3300048927 Bacteria 782
118 Ga0501036_0940460 3300049572 Bacteria 709
119 Ga0501040_0449746 3300049576 Bacteria 927
120 Ga0501068_0704150 3300049584 Bacteria 660
121 Ga0501072_0688687 3300049588 Bacteria 804
122 Ga0501073_1266193 3300049589 Bacteria 506
123 Ga0501076_1398393 3300049592 Bacteria 575
124 Ga0501211_000282 3300049658 Bacteria 4620
125 Ga0501235_002057 3300049669 Bacteria 4320
126 Ga0501236_009587 3300049670 Bacteria 1252
127 Ga0501225_0009193 3300049705 Bacteria 2821
128 Ga0501245_003824 3300049708 Bacteria 2058
129 Ga0501080_0873980 3300049742 Bacteria 785
130 Ga0501083_0981728 3300049744 Bacteria 550
131 Ga0501264_012420 3300049761 Bacteria 835
132 Ga0501045_1117388 3300049824 Bacteria 576
133 nmdc:mga0k408_299913_c1 3300050493 Bacteria 959
134 Ga0500643_000494 3300053087 Bacteria 28505
135 Ga0500555_114644 3300053103 Bacteria 676
136 Ga0500595_031060 3300053119 Bacteria 1795
137 Ga0500658_0034481 3300053134 Bacteria 1998
138 Ga0500559_0000054 3300053136 Bacteria 90695
139 Ga0500568_0073925 3300053139 Bacteria 1301
140 Ga0500573_0002818 3300053140 Bacteria 8815
141 Ga0500577_0250049 3300053142 Bacteria 770
142 Ga0500577_0255938 3300053142 Unclassified 761
143 Ga0500616_0007650 3300053153 Bacteria 6824
144 Ga0500622_0056999 3300053156 Bacteria 1999
145 Ga0500627_0026782 3300053158 Bacteria 2383
146 Ga0530510_0804833 3300061734 Bacteria 717
147 2512959918 2512875024 Bacteria 7195110
148 2600203995 2599185354 Bacteria 4398675
149 2738744548 2738541281 Bacteria 5112672
150 2739353778 2738543032 Bacteria 5115625
151 2819538380 2818991435 Bacteria 5433759
152 2819648175 2818991454 Bacteria 5563326
153 Ga0068856_100739191
154 rootL2_10301230
155 Ga0055537_1007274
156 Ga0055528_1003962
157 Ga0065165_1000561
158 Ga0065704_10155313
159 Ga0065707_10211876
160 Ga0070658_10803288
161 Ga0070680_101290485
162 Ga0070691_10040220
163 Ga0070668_100000488
164 Ga0070667_100050574
165 Ga0070714_100978281
166 Ga0070681_10070539
167 Ga0068867_102200815
168 Ga0070699_100755545
169 Ga0070679_100006088
170 Ga0068853_100071973
171 Ga0070672_101728542
172 Ga0070665_100008223
173 Ga0068855_100331638
174 Ga0068855_100703731
175 Ga0068857_100867348
176 Ga0068856_100006671
177 Ga0068852_101314711
178 Ga0068859_100565127
179 Ga0068851_10399783
180 Ga0068863_100015742
181 Ga0068860_100190538
182 Ga0068862_100000198
183 Ga0081539_10028156
184 Ga0075366_10341031
185 Ga0097620_100565098
186 Ga0079104_1023512
187 Ga0105240_10069186
188 Ga0105240_10474552
189 Ga0105240_10941761
190 Ga0105247_10036253
191 Ga0105242_10327777
192 Ga0105237_12675698
193 Ga0105238_10732164
194 Ga0105249_10000015
195 Ga0105239_11043083
196 Ga0157373_10071915
197 Ga0157373_11103906
198 Ga0157369_10010979
199 Ga0171462_1049
200 Ga0157380_10645606
201 Ga0157379_10240771
202 Ga0213873_10246753
203 Ga0213876_10179750
204 Ga0213875_10140829
205 Ga0209565_1000451
206 Ga0209673_1004519
207 Ga0209564_1001987
208 Ga0209564_1089337
209 Ga0209256_1011268
210 Ga0209257_1000352
211 Ga0207710_10011802
212 Ga0207705_10270586
213 Ga0207707_10319337
214 Ga0207695_10000321
215 Ga0207657_10051717
216 Ga0207652_10140830
217 Ga0207694_10783164
218 Ga0207664_11657850
219 Ga0207711_10060073
220 Ga0207661_11162553
221 Ga0207667_10668254
222 Ga0207667_11352476
223 Ga0207712_10000023
224 Ga0207668_10000438
225 Ga0207658_10360405
226 Ga0207703_11287824
227 Ga0207639_10338177
228 Ga0207702_10208816
229 Ga0207702_10592115
230 Ga0207641_10003216
231 Ga0207674_11473235
232 Ga0207698_10302291
233 Ga0207698_11801590
234 Ga0268266_10366054
235 Ga0268265_10000021
236 Ga0268264_10000682
237 Ga0307517_10093703
238 Ga0265324_10036141
239 Ga0265328_10305994
240 Ga0307408_100119024
241 Ga0265342_10549568
242 Ga0307516_10000004
243 Ga0307510_10132518
244 Ga0395898_0766346
245 Ga0395905_0002474
246 Ga0436364_0703484
247 Ga0395901_1892122
248 Ga0400483_066682
249 Ga0436365_0466878
250 Ga0436365_0945319
251 Ga0436360_0713559
252 Ga0436362_0106782
253 Ga0466967_1492639
254 Ga0495638_0006685
255 Ga0495616_0253504
256 Ga0495620_0027414
257 Ga0495648_0141358
258 Ga0495642_0025899
259 Ga0495654_0000016
260 Ga0495625_0033971
261 Ga0495669_0000024
262 Ga0495660_0034798
263 Ga0495677_0023417
264 Ga0495686_0101758
265 Ga0496119_0030869
266 Ga0496119_0118081
267 Ga0496120_0236531
268 Ga0496121_0070995
269 Ga0496124_0530577
270 Ga0501036_0940460
271 Ga0501040_0449746
272 Ga0501068_0704150
273 Ga0501072_0688687
274 Ga0501073_1266193
275 Ga0501076_1398393
276 Ga0501211_000282
277 Ga0501235_002057
278 Ga0501236_009587
279 Ga0501225_0009193
280 Ga0501245_003824
281 Ga0501080_0873980
282 Ga0501083_0981728
283 Ga0501264_012420
284 Ga0501045_1117388
285 nmdc:mga0k408_299913_c1
286 Ga0500643_000494
287 Ga0500555_114644
288 Ga0500595_031060
289 Ga0500658_0034481
290 Ga0500559_0000054
291 Ga0500568_0073925
292 Ga0500573_0002818
293 Ga0500577_0250049
294 Ga0500577_0255938
295 Ga0500616_0007650
296 Ga0500622_0056999
297 Ga0500627_0026782
298 Ga0530510_0804833
299 2512959918
300 2600203995
301 2738744548
302 2739353778
303 2819538380
304 2819648175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

12

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.94 1 87
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.9377 1 87
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.9296 1 87
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.9275 1 87
4v8x-assembly2.cif.gz_CY structure of thermus thermophilus ribosome 0.9158 1 87
ID Description Score Start End Superfamily
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9158 1 87 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9056 1 87 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8961 2 87 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8664 2 87 3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8643 2 87 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A480A579-F1-model_v4 Putative mRNA interferase YoeB 0.9812 1 67 GO:0004519
GO:0006401
AF-A0A7W6U9L5-F1-model_v4 deleted 0.9757 23 87
AF-A0A0S9SHB1-F1-model_v4 Putative mRNA interferase YoeB 0.9743 1 87 GO:0004519
GO:0006401
GO:0045892
AF-Q8DNR3-F1-model_v4 Putative mRNA interferase YoeB 0.9706 1 87 GO:0004519
GO:0006401
GO:0045892
AF-A0A139QRD3-F1-model_v4 Putative mRNA interferase YoeB 0.9705 1 87 GO:0004519
GO:0006401
GO:0045892

Map