F213924

General Info

Members Datasets Scaffolds Average Seq Length
152 130 304 333

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1010012|Ga0081540_10100122
Length 361
Sequence MPLFRDGKRILRRSGYVVATLARQLAVKSRLVAVFTGAVLGLIAGAGSLSQASAQGDPLPSWNDTAAKRTIIEFVDRTTTSGGPDFVPPAERIATFDNDGTLWCEQPVYFQLAFAIDQVKALAPKHPEWKTQQPFKALLEKDMKGVGAAGKTGLLQIMAATHTGMTTDEFSRSVRDWLATAKHPRFNRPFDSLVYQPMLELLAYLRANGFKTFIVSGGGIEFMRPWMEKTYGIPPEQVVGSSGVVKFQTGADGKPELIKLAKMEFVDDGPGKPVGINRFIGRRPILAFGNSDGDLQMLQWTVAGRGARLAALLHHTDAEREYAYDRQSKIGKLDKALDEATARGWTVVDMKRDWKAVFPEK

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
54 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
57 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
96 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
97 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
98 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
99 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
100 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
101 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
103 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
104 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
111 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
112 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
113 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
114 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
115 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
116 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
117 2791355199
118 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
119 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
120 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
121 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
122 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
123 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
124 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
125 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
126 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
127 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
128 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
129 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
130 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.09
Metatranscriptomes 1.32
Isolates 12.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.16
Nodule 8.55
Rhizoplane 2.63
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1010012 3300005983 Bacteria 6452
2 JGI24743J22301_10017459 3300001991 Unclassified 1347
3 Ga0070658_10139385 3300005327 Bacteria 2025
4 Ga0070670_100000035 3300005331 Bacteria 157570
5 Ga0070691_10011107 3300005341 Bacteria 4110
6 Ga0070661_100102197 3300005344 Bacteria 2133
7 Ga0070668_100003075 3300005347 Bacteria 12336
8 Ga0070669_100110884 3300005353 Bacteria 2082
9 Ga0070667_100001410 3300005367 Bacteria 21500
10 Ga0070700_100012140 3300005441 Bacteria 4795
11 Ga0070694_100085716 3300005444 Bacteria 2200
12 Ga0070695_100008563 3300005545 Bacteria 6075
13 Ga0070665_100016403 3300005548 Bacteria 7429
14 Ga0070664_100088333 3300005564 Bacteria 2680
15 Ga0068856_100177082 3300005614 Bacteria 2145
16 Ga0068859_100117744 3300005617 Bacteria 2722
17 Ga0068864_100001144 3300005618 Bacteria 22133
18 Ga0068863_100002037 3300005841 Bacteria 20029
19 Ga0068862_100000368 3300005844 Bacteria 48907
20 Ga0081455_10033612 3300005937 Bacteria 4606
21 Ga0081538_10021746 3300005981 Bacteria 4668
22 Ga0081540_1024072 3300005983 Bacteria 3542
23 Ga0081540_1031192 3300005983 Bacteria 2936
24 Ga0097621_100246272 3300006237 Bacteria 1564
25 Ga0097620_100117745 3300006931 Bacteria 2722
26 Ga0105247_10003643 3300009101 Bacteria 10008
27 Ga0105247_10076177 3300009101 Bacteria 2106
28 Ga0105248_10007747 3300009177 Bacteria 11793
29 Ga0105237_10165888 3300009545 Bacteria 2208
30 Ga0105249_10000525 3300009553 Bacteria 35250
31 Ga0157369_10002444 3300013105 Bacteria 22316
32 Ga0157378_10378243 3300013297 Bacteria 1390
33 Ga0163162_10075328 3300013306 Bacteria 3435
34 Ga0157379_10003228 3300014968 Bacteria 13814
35 Ga0209256_1000641 3300025299 Bacteria 47608
36 Ga0207710_10072285 3300025900 Bacteria 1584
37 Ga0207649_10071943 3300025920 Bacteria 2211
38 Ga0207649_10100014 3300025920 Bacteria 1917
39 Ga0207650_10000350 3300025925 Bacteria 44409
40 Ga0207664_10016924 3300025929 Bacteria 5332
41 Ga0207711_10015908 3300025941 Bacteria 6239
42 Ga0207661_10185865 3300025944 Bacteria 1818
43 Ga0207712_10002507 3300025961 Bacteria 11815
44 Ga0207668_10000035 3300025972 Bacteria 119182
45 Ga0207658_10000300 3300025986 Bacteria 51413
46 Ga0207702_10214179 3300026078 Bacteria 1792
47 Ga0207641_10006570 3300026088 Bacteria 9773
48 Ga0207676_10000970 3300026095 Bacteria 22157
49 Ga0268266_10004822 3300028379 Bacteria 12803
50 Ga0268265_10010277 3300028380 Bacteria 6321
51 Ga0307513_10094960 3300031456 Bacteria 3025
52 Ga0316575_10000886 3300031665 Bacteria 9188
53 Ga0316575_10012338 3300031665 Bacteria 3177
54 Ga0316575_10016836 3300031665 Bacteria 2770
55 Ga0316575_10026970 3300031665 Bacteria 2234
56 Ga0316579_10079249 3300031691 Bacteria 1563
57 Ga0316576_10000302 3300031727 Bacteria 21794
58 Ga0316576_10109461 3300031727 Bacteria 2070
59 Ga0316576_10222645 3300031727 Unclassified 1419
60 Ga0316578_10052161 3300031728 Bacteria 2396
61 Ga0316578_10072549 3300031728 Bacteria 2039
62 Ga0316577_10005716 3300031733 Bacteria 6532
63 Ga0316577_10040151 3300031733 Bacteria 2618
64 Ga0315911_1000007 3300033442 Bacteria 413725
65 Ga0316588_1021603 3300033528 Bacteria 1465
66 Ga0316596_1028420 3300033541 Bacteria 1445
67 Ga0373950_0008422 3300034818 Bacteria 1623
68 Ga0373940_0039198 3300035088 Bacteria 1296
69 Ga0316574_0001009 3300035398 Bacteria 12692
70 Ga0373931_0032794 3300035691 Bacteria 2689
71 Ga0316582_0009577 3300036647 Bacteria 5263
72 Ga0316582_0123117 3300036647 Bacteria 1737
73 Ga0316582_0160172 3300036647 Bacteria 1524
74 Ga0316584_0080539 3300036712 Bacteria 2439
75 Ga0316581_0053162 3300037588 Bacteria 1241
76 Ga0451577_0092933 3300042876 Bacteria 2693
77 Ga0453684_0071055 3300044712 Bacteria 4403
78 Ga0451576_0111869 3300045051 Bacteria 2842
79 Ga0495638_0000419 3300046460 Bacteria 51336
80 Ga0495650_0000007 3300046471 Bacteria 718072
81 Ga0495606_0030452 3300046507 Bacteria 3770
82 Ga0495610_0000040 3300046512 Bacteria 165165
83 Ga0495616_0105810 3300046513 Bacteria 1313
84 Ga0495643_0112592 3300046522 Bacteria 1382
85 Ga0495648_0009347 3300046524 Bacteria 7611
86 Ga0495654_0000095 3300046530 Bacteria 100179
87 Ga0495625_0000759 3300046660 Bacteria 44970
88 Ga0495625_0000793 3300046660 Bacteria 43797
89 Ga0495625_0003999 3300046660 Bacteria 14118
90 Ga0495625_0011398 3300046660 Bacteria 7255
91 Ga0495613_0036655 3300046689 Bacteria 3637
92 Ga0495589_0002084 3300046794 Bacteria 11314
93 Ga0495672_0007591 3300047320 Bacteria 8140
94 Ga0495681_0080338 3300047470 Bacteria 1457
95 Ga0495686_0006158 3300047472 Bacteria 9275
96 Ga0495686_0011012 3300047472 Bacteria 6397
97 Ga0496101_0171450 3300048904 Bacteria 1668
98 Ga0496105_0236283 3300048908 Bacteria 1484
99 Ga0496106_0006778 3300048909 Bacteria 8480
100 Ga0496107_0000023 3300048910 Bacteria 125918
101 Ga0496121_0001031 3300048924 Bacteria 49668
102 Ga0496124_0250396 3300048927 Bacteria 1311
103 Ga0496126_0022574 3300048929 Bacteria 6118
104 Ga0496126_0030622 3300048929 Bacteria 5095
105 Ga0496126_0415943 3300048929 Bacteria 1088
106 Ga0501034_0000546 3300049571 Bacteria 59719
107 Ga0501036_0256796 3300049572 Bacteria 1464
108 Ga0501043_0012820 3300049579 Bacteria 6552
109 Ga0501047_0002154 3300049581 Bacteria 18833
110 Ga0501067_0041182 3300049583 Bacteria 2565
111 Ga0501238_000385 3300049671 Bacteria 5460
112 Ga0501044_0002249 3300049823 Bacteria 22052
113 Ga0500578_0071213 3300053086 Bacteria 2216
114 Ga0500643_017790 3300053087 Bacteria 2373
115 Ga0500644_0050151 3300053088 Bacteria 1428
116 Ga0500651_0000603 3300053093 Bacteria 17890
117 Ga0500651_0018786 3300053093 Bacteria 4281
118 Ga0500651_0129846 3300053093 Bacteria 1525
119 Ga0500641_0049377 3300053096 Bacteria 1725
120 Ga0500650_0000187 3300053098 Bacteria 14970
121 Ga0500556_0000178 3300053104 Bacteria 52397
122 Ga0500562_019423 3300053108 Bacteria 1757
123 Ga0500595_001821 3300053119 Bacteria 11039
124 Ga0500658_0008527 3300053134 Bacteria 3785
125 Ga0500577_0000021 3300053142 Bacteria 43315
126 Ga0500616_0057518 3300053153 Bacteria 2026
127 Ga0500622_0003937 3300053156 Bacteria 9596
128 Ga0500627_0000811 3300053158 Bacteria 8345
129 Ga0500636_0000619 3300053177 Bacteria 19207
130 Ga0500645_000875 3300053730 Bacteria 17533
131 Ga0500645_015393 3300053730 Bacteria 2423
132 Ga0530510_0049086 3300061734 Bacteria 3050
133 2513658669 2513237096 Bacteria 8722461
134 2513920767 2513237145 Bacteria 8979722
135 2513956782 2513237150 Bacteria 6553639
136 2514045366 2513237165 Bacteria 6771773
137 2517895073 2517572143 Bacteria 9484767
138 2739612581 2739367655 Bacteria 4051151
139 2793076779
140 2858692261 2858688981 Bacteria 8184122
141 2881930196 2881927736 Bacteria 3993927
142 2901312116 2901300506 Bacteria 8463898
143 2903758344 2903748898 Bacteria 9972761
144 2906639725 2906635258 Bacteria 8601019
145 2906660530 2906660503 Bacteria 8595048
146 2908745309 2908739725 Bacteria 8628932
147 2908761799 2908756301 Bacteria 8864324
148 644747832 644736347 Bacteria 6476522
149 8006942665 8006933436 Bacteria 10410654
150 8006982394 8006973647 Bacteria 10679141
151 8019562580 8019555841 Bacteria 9642137
152 8019572655 8019565922 Bacteria 9639779
153 Ga0081540_1010012
154 JGI24743J22301_10017459
155 Ga0070658_10139385
156 Ga0070670_100000035
157 Ga0070691_10011107
158 Ga0070661_100102197
159 Ga0070668_100003075
160 Ga0070669_100110884
161 Ga0070667_100001410
162 Ga0070700_100012140
163 Ga0070694_100085716
164 Ga0070695_100008563
165 Ga0070665_100016403
166 Ga0070664_100088333
167 Ga0068856_100177082
168 Ga0068859_100117744
169 Ga0068864_100001144
170 Ga0068863_100002037
171 Ga0068862_100000368
172 Ga0081455_10033612
173 Ga0081538_10021746
174 Ga0081540_1024072
175 Ga0081540_1031192
176 Ga0097621_100246272
177 Ga0097620_100117745
178 Ga0105247_10003643
179 Ga0105247_10076177
180 Ga0105248_10007747
181 Ga0105237_10165888
182 Ga0105249_10000525
183 Ga0157369_10002444
184 Ga0157378_10378243
185 Ga0163162_10075328
186 Ga0157379_10003228
187 Ga0209256_1000641
188 Ga0207710_10072285
189 Ga0207649_10071943
190 Ga0207649_10100014
191 Ga0207650_10000350
192 Ga0207664_10016924
193 Ga0207711_10015908
194 Ga0207661_10185865
195 Ga0207712_10002507
196 Ga0207668_10000035
197 Ga0207658_10000300
198 Ga0207702_10214179
199 Ga0207641_10006570
200 Ga0207676_10000970
201 Ga0268266_10004822
202 Ga0268265_10010277
203 Ga0307513_10094960
204 Ga0316575_10000886
205 Ga0316575_10012338
206 Ga0316575_10016836
207 Ga0316575_10026970
208 Ga0316579_10079249
209 Ga0316576_10000302
210 Ga0316576_10109461
211 Ga0316576_10222645
212 Ga0316578_10052161
213 Ga0316578_10072549
214 Ga0316577_10005716
215 Ga0316577_10040151
216 Ga0315911_1000007
217 Ga0316588_1021603
218 Ga0316596_1028420
219 Ga0373950_0008422
220 Ga0373940_0039198
221 Ga0316574_0001009
222 Ga0373931_0032794
223 Ga0316582_0009577
224 Ga0316582_0123117
225 Ga0316582_0160172
226 Ga0316584_0080539
227 Ga0316581_0053162
228 Ga0451577_0092933
229 Ga0453684_0071055
230 Ga0451576_0111869
231 Ga0495638_0000419
232 Ga0495650_0000007
233 Ga0495606_0030452
234 Ga0495610_0000040
235 Ga0495616_0105810
236 Ga0495643_0112592
237 Ga0495648_0009347
238 Ga0495654_0000095
239 Ga0495625_0000759
240 Ga0495625_0000793
241 Ga0495625_0003999
242 Ga0495625_0011398
243 Ga0495613_0036655
244 Ga0495589_0002084
245 Ga0495672_0007591
246 Ga0495681_0080338
247 Ga0495686_0006158
248 Ga0495686_0011012
249 Ga0496101_0171450
250 Ga0496105_0236283
251 Ga0496106_0006778
252 Ga0496107_0000023
253 Ga0496121_0001031
254 Ga0496124_0250396
255 Ga0496126_0022574
256 Ga0496126_0030622
257 Ga0496126_0415943
258 Ga0501034_0000546
259 Ga0501036_0256796
260 Ga0501043_0012820
261 Ga0501047_0002154
262 Ga0501067_0041182
263 Ga0501238_000385
264 Ga0501044_0002249
265 Ga0500578_0071213
266 Ga0500643_017790
267 Ga0500644_0050151
268 Ga0500651_0000603
269 Ga0500651_0018786
270 Ga0500651_0129846
271 Ga0500641_0049377
272 Ga0500650_0000187
273 Ga0500556_0000178
274 Ga0500562_019423
275 Ga0500595_001821
276 Ga0500658_0008527
277 Ga0500577_0000021
278 Ga0500616_0057518
279 Ga0500622_0003937
280 Ga0500627_0000811
281 Ga0500636_0000619
282 Ga0500645_000875
283 Ga0500645_015393
284 Ga0530510_0049086
285 2513658669
286 2513920767
287 2513956782
288 2514045366
289 2517895073
290 2739612581
291 2793076779
292 2858692261
293 2881930196
294 2901312116
295 2903758344
296 2906639725
297 2906660530
298 2908745309
299 2908761799
300 644747832
301 8006942665
302 8006982394
303 8019562580
304 8019572655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

94

299

0.72

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

91

300

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9301 40 344
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.9272 40 344
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.6812 75 333
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.6705 75 333
4as3-assembly2.cif.gz_D pseudomonas aeruginosa phosphorylcholine phosphatase. orthorhombic form 0.6083 43 331
ID Description Score Start End Superfamily
4gxtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6948 51 332 3.40.50.1000
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6929 182 332 3.40.50.1000
1y8aA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6871 191 296 3.40.50.1000
4as3C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6464 43 335 3.40.50.1000
3kd3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.639 177 310 3.40.50.1000
ID Description Score Start End GO Terms
AF-X0WTZ3-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9843 170 344
AF-A0A0E3VXD4-F1-model_v4 Nonspecific acid phosphatase 0.9839 149 341
AF-A0A355GK92-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9836 173 344 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A0U2YIC5-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9817 143 342 GO:0016787
AF-A0A7Y0RQX9-F1-model_v4 deleted 0.9816 85 344

Map