F214769

General Info

Members Datasets Scaffolds Average Seq Length
152 46 304 494

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10002617|Ga0316578_100026175
Length 526
Sequence MILPFDTRLPPDALLPLLVLASSLLPGLVIFFLAEQRVRLRTLLNLGGASIKLGLVAWMLWGVYHGRSYAARLPLVDGLDLALEVGPLSLLFLILSAGLWLVTTVYAVGYLEESPNRSRFFGFFSLCVTATVGVAMAGNLLTFLLFFEMLTLTTYPLVMHRGSEAARRAGTVYLAHTMFAGALLLAGTVWLYVLAGTLTFTPRGFVADIAETRPGTLTAIFALLIGGVGVKAALVPLHSWLPRAMVAPAPVSALLHAVAVVKAGAFGVVLIVYDVFGVEQAAELGVTGPLALVAAVTILYGSLRALFQDDLKRRLAFSTVSQVSYIVLGVAIVGPLASTGGIVHLVHQGIMKITLFFCAGNLAETLGIHKISEMNGVGRRMPWTMGAFSVAALGMIGVPPIAGFITKWYLGLGALEAGLHWPLYVLTASSLLNAAYFLPILHAAWLREPTTPWAESAPGARPAAPAADGTRWPLAGWWTRPETGWLLLLPPLVTAALSLLIGLLASSPFSPLEWSLLIAEREFQYP

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
3 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
4 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
5 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
6 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
7 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
8 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
9 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
10 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
11 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
15 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
16 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
17 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
18 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
19 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
20 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
21 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
22 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
23 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
24 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
25 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
26 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
27 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
28 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
29 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
30 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
31 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
32 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
33 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
34 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
35 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
36 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
37 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
38 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
39 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
40 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
41 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
42 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
43 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
44 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
45 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
46 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 2.63
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 81.58
Stem 0
Stem Tuber 0.66
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10002617 3300031728 Bacteria 7976
2 Ga0157372_10298540 3300013307 Bacteria 1874
3 Ga0316575_10001359 3300031665 Bacteria 7852
4 Ga0316575_10003633 3300031665 Bacteria 5351
5 Ga0316575_10005953 3300031665 Bacteria 4363
6 Ga0316575_10016651 3300031665 Bacteria 2784
7 Ga0316575_10019527 3300031665 Bacteria 2593
8 Ga0316575_10025112 3300031665 Bacteria 2309
9 Ga0316579_10001050 3300031691 Bacteria 9751
10 Ga0316579_10001571 3300031691 Bacteria 8331
11 Ga0316579_10005536 3300031691 Bacteria 5107
12 Ga0316579_10009238 3300031691 Bacteria 4142
13 Ga0316579_10009335 3300031691 Bacteria 4121
14 Ga0316579_10033580 3300031691 Bacteria 2357
15 Ga0316579_10035947 3300031691 Bacteria 2284
16 Ga0316579_10065952 3300031691 Bacteria 1709
17 Ga0316576_10000126 3300031727 Bacteria 29047
18 Ga0316576_10000851 3300031727 Bacteria 15482
19 Ga0316576_10004890 3300031727 Bacteria 8102
20 Ga0316576_10006170 3300031727 Bacteria 7433
21 Ga0316576_10012257 3300031727 Bacteria 5658
22 Ga0316576_10013387 3300031727 Bacteria 5451
23 Ga0316576_10014292 3300031727 Bacteria 5303
24 Ga0316576_10014507 3300031727 Bacteria 5264
25 Ga0316576_10014765 3300031727 Bacteria 5222
26 Ga0316576_10014852 3300031727 Bacteria 5209
27 Ga0316576_10017365 3300031727 Bacteria 4886
28 Ga0316576_10024886 3300031727 Bacteria 4185
29 Ga0316576_10099715 3300031727 Bacteria 2170
30 Ga0316576_10135684 3300031727 Bacteria 1852
31 Ga0316578_10000001 3300031728 Bacteria 72102
32 Ga0316578_10000147 3300031728 Bacteria 18381
33 Ga0316578_10003710 3300031728 Bacteria 7053
34 Ga0316578_10004298 3300031728 Bacteria 6693
35 Ga0316578_10004746 3300031728 Bacteria 6471
36 Ga0316578_10005299 3300031728 Bacteria 6233
37 Ga0316578_10019439 3300031728 Bacteria 3739
38 Ga0316578_10022366 3300031728 Bacteria 3523
39 Ga0316578_10027423 3300031728 Bacteria 3220
40 Ga0316578_10028602 3300031728 Bacteria 3158
41 Ga0316578_10042659 3300031728 Bacteria 2631
42 Ga0316578_10043233 3300031728 Bacteria 2616
43 Ga0316578_10057401 3300031728 Bacteria 2287
44 Ga0316578_10094064 3300031728 Bacteria 1792
45 Ga0316577_10001737 3300031733 Bacteria 10474
46 Ga0316577_10004475 3300031733 Bacteria 7215
47 Ga0316577_10006707 3300031733 Bacteria 6104
48 Ga0316577_10011561 3300031733 Bacteria 4783
49 Ga0316577_10023298 3300031733 Bacteria 3438
50 Ga0316577_10029142 3300031733 Bacteria 3081
51 Ga0316577_10045734 3300031733 Bacteria 2446
52 Ga0316577_10056798 3300031733 Bacteria 2185
53 Ga0307410_10128985 3300031852 Bacteria 1855
54 Ga0316583_10000825 3300032133 Bacteria 9845
55 Ga0316583_10002865 3300032133 Bacteria 6051
56 Ga0316583_10036435 3300032133 Bacteria 1745
57 Ga0316585_10000695 3300032137 Bacteria 8395
58 Ga0316585_10001687 3300032137 Bacteria 5866
59 Ga0316585_10016186 3300032137 Bacteria 2243
60 Ga0316585_10021656 3300032137 Bacteria 1975
61 Ga0316580_10001128 3300032139 Bacteria 6760
62 Ga0316580_10003787 3300032139 Bacteria 4330
63 Ga0316580_10008718 3300032139 Unclassified 3043
64 Ga0316580_10009447 3300032139 Bacteria 2931
65 Ga0316580_10011388 3300032139 Bacteria 2700
66 Ga0316580_10015058 3300032139 Bacteria 2363
67 Ga0316593_10014898 3300032168 Bacteria 2329
68 Ga0316593_10021940 3300032168 Bacteria 2001
69 Ga0316592_1000261 3300033524 Bacteria 6559
70 Ga0316596_1000505 3300033541 Bacteria 6649
71 Ga0316574_0001154 3300035398 Bacteria 12178
72 Ga0316574_0001478 3300035398 Bacteria 11191
73 Ga0316574_0002327 3300035398 Bacteria 9484
74 Ga0316574_0003930 3300035398 Bacteria 7727
75 Ga0316574_0005257 3300035398 Bacteria 6892
76 Ga0316574_0012514 3300035398 Bacteria 4855
77 Ga0316574_0015591 3300035398 Bacteria 4411
78 Ga0316574_0028258 3300035398 Bacteria 3381
79 Ga0316574_0029529 3300035398 Bacteria 3313
80 Ga0316574_0029850 3300035398 Bacteria 3297
81 Ga0316574_0055299 3300035398 Bacteria 2480
82 Ga0316574_0134662 3300035398 Bacteria 1591
83 Ga0316582_0000034 3300036647 Bacteria 31889
84 Ga0316582_0004564 3300036647 Bacteria 7014
85 Ga0316582_0005075 3300036647 Bacteria 6735
86 Ga0316582_0010183 3300036647 Bacteria 5138
87 Ga0316582_0013261 3300036647 Bacteria 4633
88 Ga0316582_0013786 3300036647 Bacteria 4562
89 Ga0316582_0014098 3300036647 Bacteria 4525
90 Ga0316582_0021347 3300036647 Bacteria 3823
91 Ga0316582_0034122 3300036647 Bacteria 3131
92 Ga0316582_0062821 3300036647 Bacteria 2385
93 Ga0316582_0073465 3300036647 Bacteria 2219
94 Ga0316582_0077657 3300036647 Bacteria 2161
95 Ga0316584_0000329 3300036712 Bacteria 24394
96 Ga0316584_0000943 3300036712 Bacteria 16588
97 Ga0316584_0002512 3300036712 Bacteria 11618
98 Ga0316584_0003531 3300036712 Bacteria 10195
99 Ga0316584_0006605 3300036712 Bacteria 7859
100 Ga0316584_0006940 3300036712 Bacteria 7700
101 Ga0316584_0015463 3300036712 Bacteria 5459
102 Ga0316584_0018068 3300036712 Bacteria 5083
103 Ga0316584_0018234 3300036712 Bacteria 5061
104 Ga0316584_0019680 3300036712 Bacteria 4881
105 Ga0316584_0027462 3300036712 Bacteria 4189
106 Ga0316584_0043896 3300036712 Bacteria 3334
107 Ga0316584_0044695 3300036712 Bacteria 3304
108 Ga0316584_0044894 3300036712 Bacteria 3297
109 Ga0316584_0091351 3300036712 Bacteria 2279
110 Ga0316584_0127727 3300036712 Bacteria 1899
111 Ga0316581_0003370 3300037588 Bacteria 3973
112 Ga0400484_18313 3300038725 Bacteria 9610
113 Ga0400490_23988 3300038726 Bacteria 13614
114 Ga0400490_50525 3300038726 Unclassified 1785
115 Ga0400485_16091 3300038735 Bacteria 11514
116 Ga0400485_21592 3300038735 Bacteria 15450
117 Ga0400488_14685 3300038741 Bacteria 5314
118 Ga0400486_15780 3300038742 Bacteria 5993
119 Ga0400486_26581 3300038742 Bacteria 17802
120 Ga0400483_046771 3300039062 Bacteria 7893
121 Ga0400483_057873 3300039062 Bacteria 24525
122 Ga0400483_121972 3300039062 Bacteria 3797
123 Ga0400483_177015 3300039062 Bacteria 39327
124 Ga0400483_184460 3300039062 Bacteria 6330
125 Ga0400483_197032 3300039062 Bacteria 5627
126 Ga0400483_208983 3300039062 Bacteria 4024
127 Ga0400483_246914 3300039062 Bacteria 10247
128 Ga0400483_254969 3300039062 Bacteria 18202
129 Ga0400487_30797 3300039110 Bacteria 14421
130 Ga0400487_40075 3300039110 Bacteria 7162
131 Ga0439449_0006840 3300042007 Bacteria 4349
132 Ga0453684_0003093 3300044712 Bacteria 38362
133 Ga0501034_0043193 3300049571 Bacteria 4563
134 Ga0501040_0055690 3300049576 Bacteria 2712
135 Ga0501081_0093152 3300049743 Bacteria 2121
136 Ga0501045_0083121 3300049824 Bacteria 2362
137 2523106418 2522572158 Bacteria 6514390
138 2657686198 2657244999 Bacteria 5946535
139 2729146636 2728369097 Bacteria 4333476
140 2804755106 2802429268 Bacteria 6094027
141 2855022247 2855020534 Bacteria 3204685
142 2881101131 2881101125 Bacteria 4590519
143 2899277238 2899275550 Bacteria 3958688
144 2917558708 2917554339 Bacteria 4987857
145 2919535854 2919534386 Bacteria 4577686
146 2932400188 2932398195 Bacteria 3847976
147 2974295815 2974294766 Bacteria 3767688
148 2974324386 2974324384 Bacteria 3750535
149 2984582431 2984580707 Bacteria 3351387
150 3000408619 3000405567 Bacteria 3779330
151 640486340 640427133 Bacteria 4567418
152 651174305 651053060 Bacteria 4689946
153 Ga0316578_10002617
154 Ga0157372_10298540
155 Ga0316575_10001359
156 Ga0316575_10003633
157 Ga0316575_10005953
158 Ga0316575_10016651
159 Ga0316575_10019527
160 Ga0316575_10025112
161 Ga0316579_10001050
162 Ga0316579_10001571
163 Ga0316579_10005536
164 Ga0316579_10009238
165 Ga0316579_10009335
166 Ga0316579_10033580
167 Ga0316579_10035947
168 Ga0316579_10065952
169 Ga0316576_10000126
170 Ga0316576_10000851
171 Ga0316576_10004890
172 Ga0316576_10006170
173 Ga0316576_10012257
174 Ga0316576_10013387
175 Ga0316576_10014292
176 Ga0316576_10014507
177 Ga0316576_10014765
178 Ga0316576_10014852
179 Ga0316576_10017365
180 Ga0316576_10024886
181 Ga0316576_10099715
182 Ga0316576_10135684
183 Ga0316578_10000001
184 Ga0316578_10000147
185 Ga0316578_10003710
186 Ga0316578_10004298
187 Ga0316578_10004746
188 Ga0316578_10005299
189 Ga0316578_10019439
190 Ga0316578_10022366
191 Ga0316578_10027423
192 Ga0316578_10028602
193 Ga0316578_10042659
194 Ga0316578_10043233
195 Ga0316578_10057401
196 Ga0316578_10094064
197 Ga0316577_10001737
198 Ga0316577_10004475
199 Ga0316577_10006707
200 Ga0316577_10011561
201 Ga0316577_10023298
202 Ga0316577_10029142
203 Ga0316577_10045734
204 Ga0316577_10056798
205 Ga0307410_10128985
206 Ga0316583_10000825
207 Ga0316583_10002865
208 Ga0316583_10036435
209 Ga0316585_10000695
210 Ga0316585_10001687
211 Ga0316585_10016186
212 Ga0316585_10021656
213 Ga0316580_10001128
214 Ga0316580_10003787
215 Ga0316580_10008718
216 Ga0316580_10009447
217 Ga0316580_10011388
218 Ga0316580_10015058
219 Ga0316593_10014898
220 Ga0316593_10021940
221 Ga0316592_1000261
222 Ga0316596_1000505
223 Ga0316574_0001154
224 Ga0316574_0001478
225 Ga0316574_0002327
226 Ga0316574_0003930
227 Ga0316574_0005257
228 Ga0316574_0012514
229 Ga0316574_0015591
230 Ga0316574_0028258
231 Ga0316574_0029529
232 Ga0316574_0029850
233 Ga0316574_0055299
234 Ga0316574_0134662
235 Ga0316582_0000034
236 Ga0316582_0004564
237 Ga0316582_0005075
238 Ga0316582_0010183
239 Ga0316582_0013261
240 Ga0316582_0013786
241 Ga0316582_0014098
242 Ga0316582_0021347
243 Ga0316582_0034122
244 Ga0316582_0062821
245 Ga0316582_0073465
246 Ga0316582_0077657
247 Ga0316584_0000329
248 Ga0316584_0000943
249 Ga0316584_0002512
250 Ga0316584_0003531
251 Ga0316584_0006605
252 Ga0316584_0006940
253 Ga0316584_0015463
254 Ga0316584_0018068
255 Ga0316584_0018234
256 Ga0316584_0019680
257 Ga0316584_0027462
258 Ga0316584_0043896
259 Ga0316584_0044695
260 Ga0316584_0044894
261 Ga0316584_0091351
262 Ga0316584_0127727
263 Ga0316581_0003370
264 Ga0400484_18313
265 Ga0400490_23988
266 Ga0400490_50525
267 Ga0400485_16091
268 Ga0400485_21592
269 Ga0400488_14685
270 Ga0400486_15780
271 Ga0400486_26581
272 Ga0400483_046771
273 Ga0400483_057873
274 Ga0400483_121972
275 Ga0400483_177015
276 Ga0400483_184460
277 Ga0400483_197032
278 Ga0400483_208983
279 Ga0400483_246914
280 Ga0400483_254969
281 Ga0400487_30797
282 Ga0400487_40075
283 Ga0439449_0006840
284 Ga0453684_0003093
285 Ga0501034_0043193
286 Ga0501040_0055690
287 Ga0501081_0093152
288 Ga0501045_0083121
289 2523106418
290 2657686198
291 2729146636
292 2804755106
293 2855022247
294 2881101131
295 2899277238
296 2917558708
297 2919535854
298 2932400188
299 2974295815
300 2974324386
301 2984582431
302 3000408619
303 640486340
304 651174305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00662

Proton_antipo_N

NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus

77

121

0.97

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

137

433

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o6y-assembly1.cif.gz_5 cryo-em structure of respiratory complex i under turnover 0.9066 10 478
6u8y-assembly1.cif.gz_h structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.9051 11 486
7b0n-assembly1.cif.gz_L a 3.7-angstrom structure of yarrowia lipolytica complex i with an r121m mutation in nucm. 0.9043 10 471
6tjv-assembly1.cif.gz_D structure of the ndh-1ms complex from thermosynechococcus elongatus 0.8948 11 487
8e9h-assembly1.cif.gz_L mycobacterial respiratory complex i, fully-inserted quinone 0.8942 11 487
ID Description Score Start End Superfamily
af_P9WIX3_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8715 116 197 1.10.287.3510
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8406 7 132 1.20.1070.10
af_P23482_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8307 7 132 1.20.1070.10
af_Q2G212_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8307 7 129 1.20.1070.10
af_Q2G2H7_1_127_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8166 7 132 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7W0FE63-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.9845 10 157 GO:0016020
AF-A0A2S6R4B1-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9744 62 487 GO:0005886
GO:0016491
AF-A0A848YIP7-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.9728 81 489 GO:0005886
AF-A0A8B6S9M6-F1-model_v4 deleted 0.9704 10 372
AF-S3IBH8-F1-model_v4 Monovalent cation/H+ antiporter subunit D 0.9698 10 487 GO:0012505
GO:0016020

Map