F216482

General Info

Members Datasets Scaffolds Average Seq Length
153 106 306 105

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100011930|Ga0068857_10001193011
Length 117
Sequence MMHDWNFAVIENFDVPARSEFKAKVMELMAQVPRGRVTTYGDLAAMAGHPYAARIVGGMAHYGDTELPWHRLVNRFGGLASGYYGGREVQAQHLAAEGITCTDFIVDNFKEIRWQPI

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
27 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
48 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
49 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
50 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
51 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
52 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
60 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
63 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
64 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
65 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
94 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
95 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
96 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
97 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
98 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
99 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
100 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
101 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
102 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
103 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
106 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.1
Nodule 0
Rhizoplane 1.31
Rhizosphere 68.63
Stem 0
Stem Tuber 0
Unclassified 18.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100011930 3300005577 Bacteria 7557
2 JGI24739J22299_10028133 3300001989 Bacteria 1962
3 rootH2_10004334 3300003320 Bacteria 85448
4 rootH1_10319794 3300003323 Bacteria 1292
5 Ga0065715_10098110 3300005293 Bacteria 3596
6 Ga0070670_100014843 3300005331 Bacteria 6680
7 Ga0070660_100000556 3300005339 Bacteria 25047
8 Ga0068855_100000002 3300005563 Bacteria 616881
9 Ga0068857_100000322 3300005577 Bacteria 32987
10 Ga0068854_100007314 3300005578 Bacteria 7056
11 Ga0068856_100060402 3300005614 Bacteria 3745
12 Ga0068856_100740053 3300005614 Bacteria 1003
13 Ga0068852_100000001 3300005616 Bacteria 716526
14 Ga0068852_100022775 3300005616 Bacteria 5030
15 Ga0068863_101956580 3300005841 Unclassified 596
16 Ga0068858_100417378 3300005842 Bacteria 1290
17 Ga0081539_10170380 3300005985 Unclassified 1030
18 Ga0075365_10000054 3300006038 Bacteria 35938
19 Ga0075365_10000080 3300006038 Bacteria 27892
20 Ga0075365_10268776 3300006038 Bacteria 1199
21 Ga0075363_100001478 3300006048 Bacteria 8944
22 Ga0075364_10000937 3300006051 Bacteria 15385
23 Ga0075367_10000339 3300006178 Bacteria 16665
24 Ga0075366_10642679 3300006195 Unclassified 658
25 Ga0075370_10033348 3300006353 Bacteria 2883
26 Ga0075370_10067553 3300006353 Bacteria 2041
27 Ga0075428_100001012 3300006844 Bacteria 29814
28 Ga0105240_10000030 3300009093 Bacteria 321312
29 Ga0105240_10000886 3300009093 Bacteria 53766
30 Ga0105240_10613935 3300009093 Unclassified 1196
31 Ga0105241_10001961 3300009174 Bacteria 15578
32 Ga0105237_10000001 3300009545 Bacteria 1009213
33 Ga0105237_10000159 3300009545 Bacteria 95980
34 Ga0105238_10000480 3300009551 Bacteria 41924
35 Ga0105032_100009 3300009979 Bacteria 86569
36 Ga0105032_100012 3300009979 Bacteria 73994
37 Ga0105028_100052 3300009993 Bacteria 12313
38 Ga0105246_12604714 3300011119 Unclassified 500
39 Ga0157371_10062378 3300013102 Bacteria 2642
40 Ga0157371_10748664 3300013102 Unclassified 734
41 Ga0157370_10010096 3300013104 Bacteria 9974
42 Ga0157369_10000003 3300013105 Bacteria 507337
43 Ga0157369_10576616 3300013105 Bacteria 1162
44 Ga0157369_12277046 3300013105 Unclassified 549
45 Ga0157369_12622783 3300013105 Unclassified 509
46 Ga0157374_10257900 3300013296 Bacteria 1717
47 Ga0157372_10000007 3300013307 Bacteria 340690
48 Ga0157372_10000096 3300013307 Bacteria 91282
49 Ga0157372_10126879 3300013307 Bacteria 2934
50 Ga0157372_12066162 3300013307 Unclassified 655
51 Ga0207695_10000009 3300025913 Bacteria 1034276
52 Ga0207695_10014524 3300025913 Bacteria 9322
53 Ga0207695_10415229 3300025913 Bacteria 1230
54 Ga0207671_10000003 3300025914 Bacteria 1065461
55 Ga0207671_10000008 3300025914 Bacteria 798229
56 Ga0207657_10002368 3300025919 Bacteria 20388
57 Ga0207694_10003439 3300025924 Bacteria 12588
58 Ga0207650_10045649 3300025925 Bacteria 3224
59 Ga0207667_10000005 3300025949 Bacteria 715503
60 Ga0207667_10000048 3300025949 Bacteria 238293
61 Ga0207667_10009157 3300025949 Bacteria 11694
62 Ga0207640_10012750 3300025981 Bacteria 4798
63 Ga0207677_10542979 3300026023 Unclassified 1012
64 Ga0207703_10702189 3300026035 Unclassified 962
65 Ga0207702_11145231 3300026078 Unclassified 772
66 Ga0207674_10000563 3300026116 Bacteria 48522
67 Ga0207674_10026683 3300026116 Bacteria 6128
68 Ga0207698_10000169 3300026142 Bacteria 40939
69 Ga0207698_10210274 3300026142 Bacteria 1750
70 Ga0209813_10000225 3300027866 Bacteria 17310
71 Ga0316176_1152613 3300030732 Unclassified 688
72 Ga0314311_1257351 3300030733 Bacteria 1621
73 Ga0316180_1021397 3300030736 Bacteria 4578
74 Ga0316183_1035366 3300030742 Bacteria 8896
75 Ga0316183_1046091 3300030742 Unclassified 1529
76 Ga0316183_1127953 3300030742 Bacteria 6162
77 Ga0316183_1165569 3300030742 Bacteria 12666
78 Ga0316181_1123581 3300030744 Bacteria 76132
79 Ga0316182_1019627 3300030745 Bacteria 7628
80 Ga0316182_1073426 3300030745 Bacteria 8993
81 Ga0316182_1110800 3300030745 Bacteria 3308
82 Ga0316182_1280922 3300030745 Bacteria 2396
83 Ga0316182_1344828 3300030745 Bacteria 1277
84 Ga0316182_1379566 3300030745 Bacteria 4844
85 Ga0307405_10035322 3300031731 Bacteria 2984
86 Ga0307406_10000897 3300031901 Bacteria 16719
87 Ga0307411_10407290 3300032005 Bacteria 1126
88 Ga0395901_0096177 3300038443 Unclassified 3104
89 Ga0395901_0881231 3300038443 Bacteria 878
90 Ga0439461_0002338 3300041410 Bacteria 3016
91 Ga0451802_1938230 3300041460 Unclassified 508
92 Ga0439432_058307 3300042006 Unclassified 1194
93 Ga0450919_002828 3300042121 Bacteria 2228
94 Ga0450906_002379 3300042145 Bacteria 4117
95 Ga0439446_0000002 3300042156 Bacteria 177065
96 Ga0450909_048267 3300042185 Bacteria 662
97 Ga0439459_0249898 3300042438 Bacteria 501
98 Ga0450918_001400 3300042531 Bacteria 4811
99 Ga0450918_017777 3300042531 Bacteria 1239
100 Ga0466972_0314731 3300044658 Bacteria 731
101 Ga0466965_0000828 3300044683 Bacteria 11698
102 Ga0453684_1118824 3300044712 Bacteria 831
103 Ga0466970_0115113 3300044765 Unclassified 1470
104 Ga0466970_0740280 3300044765 Bacteria 574
105 Ga0451576_0172601 3300045051 Bacteria 2257
106 Ga0495638_0000119 3300046460 Bacteria 127603
107 Ga0495597_0165188 3300046542 Bacteria 901
108 Ga0495671_0118651 3300046692 Bacteria 1291
109 Ga0495660_0000114 3300046810 Bacteria 86218
110 Ga0495660_0244589 3300046810 Unclassified 835
111 Ga0495686_0014394 3300047472 Bacteria 5446
112 Ga0496115_0000049 3300048918 Bacteria 109919
113 Ga0496124_0172739 3300048927 Bacteria 1672
114 Ga0501034_0000187 3300049571 Bacteria 116046
115 Ga0501034_0404603 3300049571 Bacteria 1287
116 Ga0501037_0000001 3300049573 Bacteria 753276
117 Ga0501038_0016252 3300049574 Bacteria 6749
118 Ga0501070_0714741 3300049586 Unclassified 792
119 Ga0501080_0953449 3300049742 Unclassified 746
120 Ga0501044_0894449 3300049823 Unclassified 763
121 nmdc:mga03683_170444_c1 3300050489 Unclassified 989
122 nmdc:mga00v17_1352_c1 3300050491 Bacteria 12824
123 nmdc:mga0yw44_126_c1 3300050492 Bacteria 26586
124 nmdc:mga0yw44_226599_c1 3300050492 Bacteria 1240
125 nmdc:mga0yw44_242108_c1 3300050492 Bacteria 1199
126 nmdc:mga0yw44_3127_c1 3300050492 Bacteria 7266
127 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
128 nmdc:mga0k408_675851_c1 3300050493 Bacteria 606
129 nmdc:mga06z11_149972_c1 3300050494 Unclassified 1325
130 nmdc:mga04h51_364451_c1 3300050495 Unclassified 600
131 nmdc:mga07m45_32769_c1 3300050496 Bacteria 2882
132 nmdc:mga0sz30_2062_c1 3300050516 Bacteria 2688
133 Ga0500644_0005668 3300053088 Bacteria 3158
134 Ga0500583_0000444 3300053092 Bacteria 13051
135 Ga0500583_0006729 3300053092 Bacteria 3983
136 Ga0500651_0000043 3300053093 Bacteria 86502
137 Ga0500641_0000001 3300053096 Bacteria 1115973
138 Ga0500650_0015058 3300053098 Bacteria 3286
139 Ga0500650_0261960 3300053098 Unclassified 773
140 Ga0500555_000005 3300053103 Bacteria 342334
141 Ga0500569_000002 3300053109 Bacteria 127605
142 Ga0500594_0000255 3300053118 Bacteria 12627
143 Ga0500652_000001 3300053131 Bacteria 946868
144 Ga0500655_000147 3300053133 Bacteria 17635
145 Ga0500577_0000906 3300053142 Bacteria 7676
146 Ga0500577_0222368 3300053142 Unclassified 817
147 Ga0500588_0000025 3300053146 Bacteria 35507
148 Ga0500616_0000067 3300053153 Bacteria 236311
149 Ga0500616_0023038 3300053153 Bacteria 3473
150 Ga0500616_0057176 3300053153 Bacteria 2033
151 Ga0500633_0162992 3300053160 Unclassified 837
152 Ga0500570_001248 3300053724 Bacteria 11491
153 Ga0500570_182653 3300053724 Unclassified 673
154 Ga0068857_100011930
155 JGI24739J22299_10028133
156 rootH2_10004334
157 rootH1_10319794
158 Ga0065715_10098110
159 Ga0070670_100014843
160 Ga0070660_100000556
161 Ga0068855_100000002
162 Ga0068857_100000322
163 Ga0068854_100007314
164 Ga0068856_100060402
165 Ga0068856_100740053
166 Ga0068852_100000001
167 Ga0068852_100022775
168 Ga0068863_101956580
169 Ga0068858_100417378
170 Ga0081539_10170380
171 Ga0075365_10000054
172 Ga0075365_10000080
173 Ga0075365_10268776
174 Ga0075363_100001478
175 Ga0075364_10000937
176 Ga0075367_10000339
177 Ga0075366_10642679
178 Ga0075370_10033348
179 Ga0075370_10067553
180 Ga0075428_100001012
181 Ga0105240_10000030
182 Ga0105240_10000886
183 Ga0105240_10613935
184 Ga0105241_10001961
185 Ga0105237_10000001
186 Ga0105237_10000159
187 Ga0105238_10000480
188 Ga0105032_100009
189 Ga0105032_100012
190 Ga0105028_100052
191 Ga0105246_12604714
192 Ga0157371_10062378
193 Ga0157371_10748664
194 Ga0157370_10010096
195 Ga0157369_10000003
196 Ga0157369_10576616
197 Ga0157369_12277046
198 Ga0157369_12622783
199 Ga0157374_10257900
200 Ga0157372_10000007
201 Ga0157372_10000096
202 Ga0157372_10126879
203 Ga0157372_12066162
204 Ga0207695_10000009
205 Ga0207695_10014524
206 Ga0207695_10415229
207 Ga0207671_10000003
208 Ga0207671_10000008
209 Ga0207657_10002368
210 Ga0207694_10003439
211 Ga0207650_10045649
212 Ga0207667_10000005
213 Ga0207667_10000048
214 Ga0207667_10009157
215 Ga0207640_10012750
216 Ga0207677_10542979
217 Ga0207703_10702189
218 Ga0207702_11145231
219 Ga0207674_10000563
220 Ga0207674_10026683
221 Ga0207698_10000169
222 Ga0207698_10210274
223 Ga0209813_10000225
224 Ga0316176_1152613
225 Ga0314311_1257351
226 Ga0316180_1021397
227 Ga0316183_1035366
228 Ga0316183_1046091
229 Ga0316183_1127953
230 Ga0316183_1165569
231 Ga0316181_1123581
232 Ga0316182_1019627
233 Ga0316182_1073426
234 Ga0316182_1110800
235 Ga0316182_1280922
236 Ga0316182_1344828
237 Ga0316182_1379566
238 Ga0307405_10035322
239 Ga0307406_10000897
240 Ga0307411_10407290
241 Ga0395901_0096177
242 Ga0395901_0881231
243 Ga0439461_0002338
244 Ga0451802_1938230
245 Ga0439432_058307
246 Ga0450919_002828
247 Ga0450906_002379
248 Ga0439446_0000002
249 Ga0450909_048267
250 Ga0439459_0249898
251 Ga0450918_001400
252 Ga0450918_017777
253 Ga0466972_0314731
254 Ga0466965_0000828
255 Ga0453684_1118824
256 Ga0466970_0115113
257 Ga0466970_0740280
258 Ga0451576_0172601
259 Ga0495638_0000119
260 Ga0495597_0165188
261 Ga0495671_0118651
262 Ga0495660_0000114
263 Ga0495660_0244589
264 Ga0495686_0014394
265 Ga0496115_0000049
266 Ga0496124_0172739
267 Ga0501034_0000187
268 Ga0501034_0404603
269 Ga0501037_0000001
270 Ga0501038_0016252
271 Ga0501070_0714741
272 Ga0501080_0953449
273 Ga0501044_0894449
274 nmdc:mga03683_170444_c1
275 nmdc:mga00v17_1352_c1
276 nmdc:mga0yw44_126_c1
277 nmdc:mga0yw44_226599_c1
278 nmdc:mga0yw44_242108_c1
279 nmdc:mga0yw44_3127_c1
280 nmdc:mga0yw44_5_c1
281 nmdc:mga0k408_675851_c1
282 nmdc:mga06z11_149972_c1
283 nmdc:mga04h51_364451_c1
284 nmdc:mga07m45_32769_c1
285 nmdc:mga0sz30_2062_c1
286 Ga0500644_0005668
287 Ga0500583_0000444
288 Ga0500583_0006729
289 Ga0500651_0000043
290 Ga0500641_0000001
291 Ga0500650_0015058
292 Ga0500650_0261960
293 Ga0500555_000005
294 Ga0500569_000002
295 Ga0500594_0000255
296 Ga0500652_000001
297 Ga0500655_000147
298 Ga0500577_0000906
299 Ga0500577_0222368
300 Ga0500588_0000025
301 Ga0500616_0000067
302 Ga0500616_0023038
303 Ga0500616_0057176
304 Ga0500633_0162992
305 Ga0500570_001248
306 Ga0500570_182653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

20

99

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9217 6 84
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9146 6 83
1t39-assembly2.cif.gz_B human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna 0.8955 7 84
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.885 7 83
7e1p-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine 0.881 7 87
ID Description Score Start End Superfamily
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9465 6 102 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9434 7 83 1.10.10.10
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9179 6 102 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9144 6 83 1.10.10.10
af_A0A1D8PU47_6_130_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8946 7 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1M3BTV1-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 1.001 4 102 GO:0003824
GO:0006281
AF-A0A258G637-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9953 7 104 GO:0003824
GO:0006281
AF-A0A0G1VD76-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9894 3 103 GO:0003824
GO:0006281
AF-A0A2V9R6E2-F1-model_v4 Cysteine methyltransferase 0.987 7 61 GO:0006281
GO:0008168
GO:0032259
AF-A0A258G2L5-F1-model_v4 Cysteine methyltransferase 0.9854 16 102 GO:0006281
GO:0008168
GO:0032259

Map