F216916

General Info

Members Datasets Scaffolds Average Seq Length
153 111 152 442

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10064655|Ga0105238_100646553
Length 466
Sequence MNIEALQFNHHRRRSTLFASMFAVALAVTLFAGCRSADQCGCTSCAAESQSDTPPKGFTALFDGTDLNGWWGATTEDPRKYLALSPEDFKAKHDASLADIHKHWSVQNGELVNDGNGLYLTTEKNYGDFELLVDYKTVPLADSGIYLRGCPQVQIWDSTEQDKFKLGADKGSGGLWNNSPGAPGKDPLVKADKPFGQWNHFHVIMVGSRVWVWLNGKKTVDGAILENYYDRGSAVPPRGPIQLQTHGGEIRWKNLFIREIRSDEAIQRLRGKKDPKGFKPVFNGKNFDGWAGPLDCCAITNGTIIWQQHKGGTIYTKESFSNFIARVEFNLPPGGNNGLAIRYPGEGDTAYMGMCESQVLDDNYEKDTGDKIDPRQAHGSAYGMVAAQRGYQHPIREWNYEEVTVVGHKIKVELNGTVILDCDLAPVTEFMHNREHPGKDRLSGYFGFAGHNDPVMFRNISIKPLD

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
77 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
78 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
79 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 8.5
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10202343 3300003320 Bacteria 5203
2 Ga0065704_10093807 3300005289 Bacteria 2577
3 Ga0065712_10001760 3300005290 Bacteria 10349
4 Ga0065712_10077190 3300005290 Bacteria 3535
5 Ga0065715_10089407 3300005293 Bacteria 10476
6 Ga0065707_10099770 3300005295 Bacteria 2981
7 Ga0070690_100030655 3300005330 Unclassified 3344
8 Ga0070690_100055482 3300005330 Bacteria 2538
9 Ga0070670_100187713 3300005331 Bacteria 1795
10 Ga0070689_100001129 3300005340 Bacteria 16818
11 Ga0070689_100003999 3300005340 Bacteria 9910
12 Ga0070675_100014567 3300005354 Bacteria 6201
13 Ga0070673_100129273 3300005364 Unclassified 2117
14 Ga0070688_100021152 3300005365 Bacteria 3796
15 Ga0070688_100052834 3300005365 Bacteria 2540
16 Ga0070713_100052937 3300005436 Bacteria 3362
17 Ga0070700_100121034 3300005441 Unclassified 1754
18 Ga0070694_100087020 3300005444 Bacteria 2185
19 Ga0070662_100049626 3300005457 Bacteria 3027
20 Ga0070662_100090597 3300005457 Unclassified 2296
21 Ga0070685_10011489 3300005466 Bacteria 4635
22 Ga0070672_100004226 3300005543 Bacteria 9389
23 Ga0070686_100015514 3300005544 Bacteria 4415
24 Ga0070686_100078172 3300005544 Bacteria 2184
25 Ga0070696_100203335 3300005546 Bacteria 1480
26 Ga0070665_100008017 3300005548 Bacteria 10700
27 Ga0070704_100015511 3300005549 Unclassified 4788
28 Ga0068855_100027647 3300005563 Bacteria 6785
29 Ga0068857_100074768 3300005577 Bacteria 3020
30 Ga0068856_100001678 3300005614 Bacteria 23187
31 Ga0068856_100196496 3300005614 Bacteria 2031
32 Ga0070702_100090681 3300005615 Unclassified 1853
33 Ga0068859_100017052 3300005617 Bacteria 7291
34 Ga0068859_100103082 3300005617 Bacteria 2911
35 Ga0068864_100007322 3300005618 Bacteria 9081
36 Ga0068864_100042366 3300005618 Bacteria 3896
37 Ga0068866_10050110 3300005718 Unclassified 2119
38 Ga0068860_100051816 3300005843 Unclassified 3904
39 Ga0075367_10017677 3300006178 Bacteria 3918
40 Ga0097621_100062437 3300006237 Unclassified 3059
41 Ga0075428_100008672 3300006844 Bacteria 11276
42 Ga0075429_100062107 3300006880 Bacteria 3255
43 Ga0097620_100017052 3300006931 Bacteria 7291
44 Ga0097620_100103089 3300006931 Bacteria 2911
45 Ga0105240_10000154 3300009093 Bacteria 140842
46 Ga0105240_10001489 3300009093 Bacteria 39873
47 Ga0105240_10025172 3300009093 Bacteria 7827
48 Ga0105240_10235899 3300009093 Bacteria 2123
49 Ga0111539_10018944 3300009094 Bacteria 8512
50 Ga0111539_10144552 3300009094 Bacteria 2784
51 Ga0111539_10204349 3300009094 Bacteria 2303
52 Ga0105243_10082402 3300009148 Bacteria 2629
53 Ga0105248_10029958 3300009177 Bacteria 6073
54 Ga0105248_10129610 3300009177 Bacteria 2845
55 Ga0105238_10000096 3300009551 Bacteria 98336
56 Ga0105238_10064655 3300009551 Bacteria 3658
57 Ga0105249_10115025 3300009553 Unclassified 2548
58 Ga0157375_10000006 3300013308 Bacteria 384086
59 Ga0157375_10093621 3300013308 Bacteria 3071
60 Ga0163163_10000099 3300014325 Bacteria 91490
61 Ga0163163_10010306 3300014325 Bacteria 8401
62 Ga0157379_10049056 3300014968 Bacteria 3769
63 Ga0157376_10164282 3300014969 Bacteria 2016
64 Ga0163161_10004849 3300017792 Bacteria 9367
65 Ga0207695_10000093 3300025913 Bacteria 270427
66 Ga0207695_10053577 3300025913 Bacteria 4219
67 Ga0207652_10131116 3300025921 Bacteria 2236
68 Ga0207694_10003415 3300025924 Bacteria 12641
69 Ga0207694_10040281 3300025924 Bacteria 3596
70 Ga0207650_10129354 3300025925 Bacteria 1974
71 Ga0207664_10087648 3300025929 Bacteria 2545
72 Ga0207706_10017751 3300025933 Bacteria 6408
73 Ga0207706_10051853 3300025933 Bacteria 3622
74 Ga0207670_10067507 3300025936 Bacteria 2461
75 Ga0207691_10114699 3300025940 Bacteria 2393
76 Ga0207679_10092104 3300025945 Bacteria 2348
77 Ga0207667_10043395 3300025949 Bacteria 4772
78 Ga0207651_10062432 3300025960 Bacteria 2597
79 Ga0207639_10018630 3300026041 Bacteria 4937
80 Ga0207708_10147002 3300026075 Bacteria 1853
81 Ga0207702_10001838 3300026078 Bacteria 20897
82 Ga0207641_10059439 3300026088 Bacteria 3255
83 Ga0207641_10127312 3300026088 Bacteria 2282
84 Ga0207641_10180282 3300026088 Bacteria 1934
85 Ga0207648_10059567 3300026089 Bacteria 3330
86 Ga0207676_10191881 3300026095 Unclassified 1798
87 Ga0207674_10171985 3300026116 Archaea 2119
88 Ga0207683_10071543 3300026121 Bacteria 3066
89 Ga0207698_10134275 3300026142 Unclassified 2120
90 Ga0265318_10003665 3300028577 Bacteria 7669
91 Ga0307515_10098663 3300028794 Bacteria 3555
92 Ga0265320_10006117 3300031240 Bacteria 7624
93 Ga0265329_10004112 3300031242 Bacteria 6163
94 Ga0265327_10001447 3300031251 Bacteria 29880
95 Ga0265327_10009065 3300031251 Bacteria 7269
96 Ga0265314_10000603 3300031711 Bacteria 44645
97 Ga0307414_10108123 3300032004 Bacteria 2109
98 Ga0373937_0034977 3300036401 Bacteria 4570
99 Ga0373937_0084659 3300036401 Unclassified 2934
100 Ga0395905_0085377 3300037471 Bacteria 2958
101 Ga0450895_000068 3300042132 Bacteria 3961
102 Ga0450896_000240 3300042133 Bacteria 4986
103 Ga0439446_0023009 3300042156 Bacteria 1770
104 Ga0439464_0008930 3300042439 Bacteria 2629
105 Ga0451577_0000545 3300042876 Bacteria 61714
106 Ga0451577_0001834 3300042876 Bacteria 27087
107 Ga0451577_0004979 3300042876 Bacteria 13780
108 Ga0451577_0148040 3300042876 Unclassified 2112
109 Ga0453684_0003870 3300044712 Bacteria 32955
110 Ga0453684_0021095 3300044712 Bacteria 9762
111 Ga0453684_0089059 3300044712 Unclassified 3819
112 Ga0453684_0238232 3300044712 Bacteria 2096
113 Ga0453684_0274043 3300044712 Bacteria 1927
114 Ga0453684_0412474 3300044712 Bacteria 1510
115 Ga0451576_0000146 3300045051 Bacteria 179707
116 Ga0451576_0001033 3300045051 Bacteria 51422
117 Ga0495629_0109912 3300046459 Unclassified 1922
118 Ga0495662_0013311 3300046476 Bacteria 4004
119 Ga0495630_0000518 3300046517 Bacteria 28423
120 Ga0495643_0000265 3300046522 Bacteria 76016
121 Ga0495640_0057045 3300046533 Unclassified 2666
122 Ga0495586_0002579 3300046535 Bacteria 9803
123 Ga0495634_0051676 3300046642 Bacteria 2757
124 Ga0495647_0024725 3300046681 Unclassified 2189
125 Ga0495658_0018044 3300046683 Bacteria 3660
126 Ga0495674_0001365 3300047319 Bacteria 23807
127 Ga0495676_0007124 3300047321 Bacteria 10265
128 Ga0496104_0004986 3300048907 Bacteria 11589
129 Ga0496104_0018735 3300048907 Bacteria 6320
130 Ga0496105_0030319 3300048908 Bacteria 4432
131 Ga0496105_0061166 3300048908 Bacteria 3107
132 Ga0496105_0102882 3300048908 Unclassified 2359
133 Ga0496106_0018464 3300048909 Bacteria 5157
134 Ga0496109_0027802 3300048912 Bacteria 5054
135 Ga0496109_0048803 3300048912 Unclassified 3852
136 Ga0496109_0169624 3300048912 Bacteria 2047
137 Ga0496112_0006757 3300048915 Bacteria 10106
138 Ga0496113_0019586 3300048916 Bacteria 4737
139 Ga0496114_0017198 3300048917 Bacteria 5832
140 Ga0496115_0012870 3300048918 Bacteria 6309
141 Ga0496121_0156287 3300048924 Bacteria 1673
142 Ga0501031_0000052 3300049568 Bacteria 63006
143 Ga0501033_0003164 3300049570 Bacteria 13678
144 Ga0501043_0208960 3300049579 Bacteria 1513
145 Ga0501080_0063925 3300049742 Bacteria 3424
146 Ga0501035_0017640 3300049822 Bacteria 6584
147 Ga0501035_0054835 3300049822 Bacteria 3560
148 Ga0501044_0002335 3300049823 Bacteria 21627
149 Ga0501044_0068181 3300049823 Bacteria 3624
150 Ga0495601_0043145 3300053077 Unclassified 2833
151 Ga0500568_0004636 3300053139 Bacteria 7312
152 Ga0500616_0005477 3300053153 Bacteria 8617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10092104 Ga0207679_100921041 372
2 3300005295 Ga0065707_10099770 Ga0065707_100997702 412
3 3300045051 Ga0451576_0001033 Ga0451576_0001033_43191_44504 420
4 3300026088 Ga0207641_10180282 Ga0207641_101802822 421
5 3300046459 Ga0495629_0109912 Ga0495629_0109912_622_1899 421
6 3300046533 Ga0495640_0057045 Ga0495640_0057045_44_1321 421
7 3300005290 Ga0065712_10077190 Ga0065712_100771904 422
8 3300005340 Ga0070689_100003999 Ga0070689_1000039997 422
9 3300005365 Ga0070688_100021152 Ga0070688_1000211524 422
10 3300026116 Ga0207674_10171985 Ga0207674_101719852 422
11 3300048924 Ga0496121_0156287 Ga0496121_0156287_315_1616 422
12 3300036401 Ga0373937_0034977 Ga0373937_0034977_259_1566 423
13 3300044712 Ga0453684_0412474 Ga0453684_0412474_192_1472 426
14 3300009551 Ga0105238_10000096 Ga0105238_1000009679 427
15 3300048907 Ga0496104_0018735 Ga0496104_0018735_1868_3211 428
16 3300048908 Ga0496105_0061166 Ga0496105_0061166_1697_3040 428
17 3300048912 Ga0496109_0048803 Ga0496109_0048803_376_1719 428
18 3300005444 Ga0070694_100087020 Ga0070694_1000870202 429
19 3300005544 Ga0070686_100078172 Ga0070686_1000781721 429
20 3300025924 Ga0207694_10003415 Ga0207694_100034152 429
21 3300053153 Ga0500616_0005477 Ga0500616_0005477_4471_5829 429
22 3300005843 Ga0068860_100051816 Ga0068860_1000518162 430
23 3300006844 Ga0075428_100008672 Ga0075428_1000086723 430
24 3300006880 Ga0075429_100062107 Ga0075429_1000621071 430
25 3300009094 Ga0111539_10018944 Ga0111539_100189444 430
26 3300053139 Ga0500568_0004636 Ga0500568_0004636_4313_5674 430
27 iso_pu_bacteria 2684623219 2687236962 430
28 3300005289 Ga0065704_10093807 Ga0065704_100938072 431
29 3300045051 Ga0451576_0000146 Ga0451576_0000146_97115_98425 431
30 3300042132 Ga0450895_000068 Ga0450895_000068_332_1636 432
31 3300042133 Ga0450896_000240 Ga0450896_000240_796_2100 432
32 3300028577 Ga0265318_10003665 Ga0265318_100036657 434
33 3300031240 Ga0265320_10006117 Ga0265320_100061178 434
34 3300044712 Ga0453684_0274043 Ga0453684_0274043_452_1765 434
35 3300046522 Ga0495643_0000265 Ga0495643_0000265_1191_2519 434
36 3300046683 Ga0495658_0018044 Ga0495658_0018044_718_2028 434
37 3300005290 Ga0065712_10001760 Ga0065712_100017606 435
38 3300005293 Ga0065715_10089407 Ga0065715_100894075 435
39 3300005354 Ga0070675_100014567 Ga0070675_1000145673 435
40 3300005364 Ga0070673_100129273 Ga0070673_1001292731 435
41 3300005441 Ga0070700_100121034 Ga0070700_1001210342 435
42 3300005457 Ga0070662_100090597 Ga0070662_1000905972 435
43 3300005466 Ga0070685_10011489 Ga0070685_100114892 435
44 3300005543 Ga0070672_100004226 Ga0070672_1000042268 435
45 3300005544 Ga0070686_100015514 Ga0070686_1000155143 435
46 3300005548 Ga0070665_100008017 Ga0070665_1000080176 435
47 3300005549 Ga0070704_100015511 Ga0070704_1000155113 435
48 3300005615 Ga0070702_100090681 Ga0070702_1000906812 435
49 3300005618 Ga0068864_100007322 Ga0068864_1000073221 435
50 3300006178 Ga0075367_10017677 Ga0075367_100176773 435
51 3300006237 Ga0097621_100062437 Ga0097621_1000624372 435
52 3300009177 Ga0105248_10029958 Ga0105248_100299582 435
53 3300009553 Ga0105249_10115025 Ga0105249_101150252 435
54 3300013308 Ga0157375_10093621 Ga0157375_100936212 435
55 3300025933 Ga0207706_10017751 Ga0207706_100177511 435
56 3300025940 Ga0207691_10114699 Ga0207691_101146992 435
57 3300025960 Ga0207651_10062432 Ga0207651_100624321 435
58 3300026121 Ga0207683_10071543 Ga0207683_100715432 435
59 3300026142 Ga0207698_10134275 Ga0207698_101342752 435
60 3300028794 Ga0307515_10098663 Ga0307515_100986632 435
61 3300031251 Ga0265327_10009065 Ga0265327_100090652 435
62 3300042876 Ga0451577_0000545 Ga0451577_0000545_6512_7849 435
63 3300048908 Ga0496105_0102882 Ga0496105_0102882_200_1516 435
64 3300048912 Ga0496109_0027802 Ga0496109_0027802_76_1392 435
65 3300048915 Ga0496112_0006757 Ga0496112_0006757_8693_10009 435
66 3300048916 Ga0496113_0019586 Ga0496113_0019586_302_1618 435
67 3300005331 Ga0070670_100187713 Ga0070670_1001877132 436
68 3300005457 Ga0070662_100049626 Ga0070662_1000496262 436
69 3300005718 Ga0068866_10050110 Ga0068866_100501102 436
70 3300009148 Ga0105243_10082402 Ga0105243_100824022 436
71 3300009177 Ga0105248_10129610 Ga0105248_101296102 436
72 3300014968 Ga0157379_10049056 Ga0157379_100490563 436
73 3300017792 Ga0163161_10004849 Ga0163161_100048496 436
74 3300025925 Ga0207650_10129354 Ga0207650_101293542 436
75 3300025933 Ga0207706_10051853 Ga0207706_100518532 436
76 3300026041 Ga0207639_10018630 Ga0207639_100186303 436
77 3300026088 Ga0207641_10127312 Ga0207641_101273122 436
78 3300026089 Ga0207648_10059567 Ga0207648_100595673 436
79 3300042876 Ga0451577_0148040 Ga0451577_0148040_178_1494 436
80 3300044712 Ga0453684_0089059 Ga0453684_0089059_299_1615 436
81 3300048907 Ga0496104_0004986 Ga0496104_0004986_7344_8663 436
82 3300048908 Ga0496105_0030319 Ga0496105_0030319_710_2029 436
83 3300048912 Ga0496109_0169624 Ga0496109_0169624_70_1389 436
84 3300048917 Ga0496114_0017198 Ga0496114_0017198_3333_4652 436
85 3300048918 Ga0496115_0012870 Ga0496115_0012870_3937_5256 436
86 3300049579 Ga0501043_0208960 Ga0501043_0208960_183_1499 436
87 3300005546 Ga0070696_100203335 Ga0070696_1002033351 437
88 3300044712 Ga0453684_0238232 Ga0453684_0238232_536_1849 437
89 3300048909 Ga0496106_0018464 Ga0496106_0018464_2791_4113 437
90 3300005436 Ga0070713_100052937 Ga0070713_1000529372 440
91 3300005577 Ga0068857_100074768 Ga0068857_1000747684 440
92 3300014325 Ga0163163_10010306 Ga0163163_100103067 440
93 3300014969 Ga0157376_10164282 Ga0157376_101642822 440
94 3300032004 Ga0307414_10108123 Ga0307414_101081232 440
95 3300036401 Ga0373937_0084659 Ga0373937_0084659_495_1817 440
96 3300037471 Ga0395905_0085377 Ga0395905_0085377_756_2096 440
97 3300005330 Ga0070690_100030655 Ga0070690_1000306552 441
98 3300005340 Ga0070689_100001129 Ga0070689_1000011292 441
99 3300005365 Ga0070688_100052834 Ga0070688_1000528342 441
100 3300005617 Ga0068859_100017052 Ga0068859_1000170525 441
101 3300005618 Ga0068864_100042366 Ga0068864_1000423662 441
102 3300006931 Ga0097620_100017052 Ga0097620_1000170525 441
103 3300013308 Ga0157375_10000006 Ga0157375_10000006299 441
104 3300025936 Ga0207670_10067507 Ga0207670_100675071 441
105 3300026088 Ga0207641_10059439 Ga0207641_100594393 441
106 3300026095 Ga0207676_10191881 Ga0207676_101918811 441
107 3300042876 Ga0451577_0001834 Ga0451577_0001834_24423_25754 441
108 3300044712 Ga0453684_0021095 Ga0453684_0021095_7639_8970 441
109 3300009093 Ga0105240_10000154 Ga0105240_1000015455 442
110 3300009093 Ga0105240_10001489 Ga0105240_1000148916 442
111 3300025913 Ga0207695_10000093 Ga0207695_10000093163 442
112 3300025913 Ga0207695_10053577 Ga0207695_100535773 442
113 3300025921 Ga0207652_10131116 Ga0207652_101311162 442
114 3300044712 Ga0453684_0003870 Ga0453684_0003870_292_1623 442
115 3300046476 Ga0495662_0013311 Ga0495662_0013311_2023_3363 442
116 3300046517 Ga0495630_0000518 Ga0495630_0000518_2756_4096 442
117 3300046535 Ga0495586_0002579 Ga0495586_0002579_2751_4091 442
118 3300046642 Ga0495634_0051676 Ga0495634_0051676_1106_2446 442
119 3300046681 Ga0495647_0024725 Ga0495647_0024725_754_2094 442
120 3300047319 Ga0495674_0001365 Ga0495674_0001365_19758_21098 442
121 3300047321 Ga0495676_0007124 Ga0495676_0007124_2760_4100 442
122 3300031251 Ga0265327_10001447 Ga0265327_100014472 443
123 3300049568 Ga0501031_0000052 Ga0501031_0000052_4778_6115 443
124 3300049570 Ga0501033_0003164 Ga0501033_0003164_2241_3578 443
125 3300049742 Ga0501080_0063925 Ga0501080_0063925_1074_2408 443
126 3300049822 Ga0501035_0054835 Ga0501035_0054835_497_1834 443
127 3300049823 Ga0501044_0002335 Ga0501044_0002335_4466_5803 443
128 3300009093 Ga0105240_10235899 Ga0105240_102358991 444
129 3300025929 Ga0207664_10087648 Ga0207664_100876481 444
130 3300049822 Ga0501035_0017640 Ga0501035_0017640_2356_3705 444
131 3300049823 Ga0501044_0068181 Ga0501044_0068181_934_2283 444
132 3300005614 Ga0068856_100196496 Ga0068856_1001964961 445
133 3300005617 Ga0068859_100103082 Ga0068859_1001030822 445
134 3300006931 Ga0097620_100103089 Ga0097620_1001030892 445
135 3300025924 Ga0207694_10040281 Ga0207694_100402813 445
136 3300005330 Ga0070690_100055482 Ga0070690_1000554822 446
137 3300009094 Ga0111539_10144552 Ga0111539_101445522 446
138 3300009094 Ga0111539_10204349 Ga0111539_102043492 446
139 3300026075 Ga0207708_10147002 Ga0207708_101470021 446
140 3300042156 Ga0439446_0023009 Ga0439446_0023009_206_1564 446
141 3300009093 Ga0105240_10025172 Ga0105240_100251725 447
142 3300042439 Ga0439464_0008930 Ga0439464_0008930_74_1435 448
143 3300014325 Ga0163163_10000099 Ga0163163_1000009976 449
144 3300031242 Ga0265329_10004112 Ga0265329_100041125 449
145 3300031711 Ga0265314_10000603 Ga0265314_1000060324 449
146 3300053077 Ga0495601_0043145 Ga0495601_0043145_1252_2646 453
147 3300005563 Ga0068855_100027647 Ga0068855_1000276475 455
148 3300005614 Ga0068856_100001678 Ga0068856_10000167814 455
149 3300025949 Ga0207667_10043395 Ga0207667_100433952 455
150 3300026078 Ga0207702_10001838 Ga0207702_100018389 455
151 3300042876 Ga0451577_0004979 Ga0451577_0004979_7598_8980 457
152 3300003320 rootH2_10202343 rootH2_102023432 463
153 3300009551 Ga0105238_10064655 Ga0105238_100646553 463

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

277

463

0.92

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

57

258

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.852 275 462
3hbk-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase, was domain of unknown function (duf1080) (yp_001302580.1) from parabacteroides distasonis atcc 8503 at 2.36 a resolution 0.8373 274 463
3s5q-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8364 273 462
3h3l-assembly2.cif.gz_B crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution 0.8293 272 462
3h3l-assembly1.cif.gz_A-2 crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution 0.8275 272 462
ID Description Score Start End Superfamily
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8412 274 463 2.60.120.560
3immB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8206 275 462 2.60.120.560
3immB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.797 275 462 2.60.120.560
4hxcA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7947 271 463 2.60.120.560
3h3lC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.78 269 462 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A800M941-F1-model_v4 DUF1080 domain-containing protein 0.9962 139 246 GO:0016787
AF-A0A354FTM3-F1-model_v4 DUF1080 domain-containing protein 0.9827 51 258 GO:0016787
AF-A0A3D4A634-F1-model_v4 DUF1080 domain-containing protein 0.9795 49 463 GO:0016787
AF-X1K6G5-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9789 124 259 GO:0016787
AF-A0A7V3D4L8-F1-model_v4 DUF1080 domain-containing protein 0.9762 293 463 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map