F217495

General Info

Members Datasets Scaffolds Average Seq Length
153 125 306 170

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0032795|Ga0373945_0032795_404_979
Length 191
Sequence VAPVREPQEELVSEPFLGEIRIFGFSFAPKGWALCAGQTLPINQNAALFSLLGTTYGGNGQTTFQLPDLQGRVVLSSGQGPGLTNRNLGEKLGSASVALTTQQMPLHNHPVNCTNLPGSLTGNPLGNPANQVWAADAGGVTQEYAPPSANLQAMDPRAIGNTGSGLPHENQTPYLVINYSIALQGIFPTRN

Samples

Sample ID Description Type Environment
1 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
110 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
114 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
118 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
119 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
120 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
121 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
122 2919085039 Luteibacter sp. 1214 Isolate Unclassified
123 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
124 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
125 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.16
Metatranscriptomes 2.61
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 2.61
Rhizoplane 1.96
Rhizosphere 75.16
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373945_0032795 3300035116 Bacteria 1842
2 rootH1_10066339 3300003323 Bacteria 7662
3 Ga0055535_1000123 3300003761 Bacteria 83521
4 Ga0055529_1000159 3300003763 Bacteria 93013
5 Ga0058863_11734117 3300004799 Unclassified 1269
6 Ga0058861_11892879 3300004800 Bacteria 1301
7 Ga0058862_10112573 3300004803 Bacteria 1073
8 Ga0070658_10000096 3300005327 Bacteria 77523
9 Ga0070658_10000519 3300005327 Bacteria 33450
10 Ga0070670_100024409 3300005331 Bacteria 5199
11 Ga0070680_100200220 3300005336 Unclassified 1684
12 Ga0070709_10069656 3300005434 Bacteria 2266
13 Ga0070713_101070766 3300005436 Bacteria 779
14 Ga0070706_100014913 3300005467 Bacteria 7178
15 Ga0070706_100589574 3300005467 Bacteria 1033
16 Ga0070707_100132030 3300005468 Bacteria 2428
17 Ga0070698_100080253 3300005471 Bacteria 3257
18 Ga0070699_100224132 3300005518 Bacteria 1676
19 Ga0070679_100696975 3300005530 Bacteria 958
20 Ga0070697_100029688 3300005536 Unclassified 4386
21 Ga0070697_100467276 3300005536 Bacteria 1100
22 Ga0068855_100000086 3300005563 Bacteria 111462
23 Ga0068855_100256897 3300005563 Unclassified 1948
24 Ga0068858_100765101 3300005842 Unclassified 941
25 Ga0075365_10031839 3300006038 Bacteria 3386
26 Ga0075428_100009880 3300006844 Bacteria 10605
27 Ga0075431_100019275 3300006847 Bacteria 6954
28 Ga0105240_10000002 3300009093 Bacteria 1924170
29 Ga0105240_10003040 3300009093 Bacteria 26390
30 Ga0105240_10004382 3300009093 Bacteria 21554
31 Ga0105240_11069548 3300009093 Bacteria 860
32 Ga0114129_10221149 3300009147 Bacteria 2554
33 Ga0114129_11066493 3300009147 Bacteria 1013
34 Ga0105249_10918679 3300009553 Unclassified 942
35 Ga0105239_10304861 3300010375 Unclassified 1794
36 Ga0157370_10000484 3300013104 Bacteria 49539
37 Ga0157378_10052127 3300013297 Bacteria 3640
38 Ga0157380_10517980 3300014326 Bacteria 1162
39 Ga0157376_10005919 3300014969 Bacteria 8584
40 Ga0213873_10086766 3300021358 Unclassified 883
41 Ga0213874_10016801 3300021377 Unclassified 1954
42 Ga0213876_10194411 3300021384 Viruses 1078
43 Ga0209563_108811 3300025230 Unclassified 1568
44 Ga0209258_100060 3300025242 Bacteria 319881
45 Ga0209148_1003371 3300025254 Bacteria 4471
46 Ga0209759_1000282 3300025256 Bacteria 71259
47 Ga0209129_1000835 3300025258 Bacteria 19351
48 Ga0209455_1000136 3300025272 Bacteria 146375
49 Ga0209758_1029974 3300025297 Bacteria 2262
50 Ga0207699_10722182 3300025906 Bacteria 730
51 Ga0207705_10000141 3300025909 Bacteria 77000
52 Ga0207705_10016217 3300025909 Bacteria 5343
53 Ga0207684_11004123 3300025910 Bacteria 698
54 Ga0207695_10000002 3300025913 Bacteria 2188391
55 Ga0207695_10011071 3300025913 Bacteria 10955
56 Ga0207695_10016376 3300025913 Bacteria 8675
57 Ga0207660_10175176 3300025917 Unclassified 1663
58 Ga0207652_10051877 3300025921 Bacteria 3518
59 Ga0207652_10634751 3300025921 Bacteria 956
60 Ga0207646_10316667 3300025922 Bacteria 1410
61 Ga0207665_10468673 3300025939 Viruses 969
62 Ga0207667_10000229 3300025949 Bacteria 78821
63 Ga0265328_10011283 3300031239 Bacteria 3577
64 Ga0265327_10000499 3300031251 Bacteria 68183
65 Ga0265316_10502118 3300031344 Bacteria 866
66 Ga0307516_10000442 3300031730 Bacteria 54561
67 Ga0307412_10102143 3300031911 Bacteria 2030
68 Ga0373923_0512869 3300035111 Bacteria 585
69 Ga0373945_0066252 3300035116 Bacteria 1358
70 Ga0373954_0128336 3300035118 Unclassified 1233
71 Ga0373955_0031560 3300035172 Bacteria 2776
72 Ga0373955_0471487 3300035172 Bacteria 766
73 Ga0373935_0575330 3300035692 Bacteria 822
74 Ga0373927_0012460 3300035695 Bacteria 5662
75 Ga0373927_0107862 3300035695 Bacteria 1814
76 Ga0373933_0015219 3300035724 Bacteria 4288
77 Ga0373933_0569153 3300035724 Unclassified 744
78 Ga0373947_0014783 3300035725 Bacteria 4479
79 Ga0373947_0083237 3300035725 Bacteria 1984
80 Ga0373947_0098950 3300035725 Unclassified 1830
81 Ga0373947_0598093 3300035725 Bacteria 752
82 Ga0373937_0010746 3300036401 Bacteria 8009
83 Ga0373937_0435811 3300036401 Unclassified 1244
84 Ga0373937_0912124 3300036401 Bacteria 827
85 Ga0373925_0000163 3300037068 Bacteria 71614
86 Ga0373925_0162604 3300037068 Bacteria 1759
87 Ga0436364_0461640 3300037853 Bacteria 4057
88 Ga0436365_0067640 3300039437 Bacteria 4346
89 Ga0436363_0434313 3300039450 Unclassified 922
90 Ga0436363_1033648 3300039450 Bacteria 2142
91 Ga0436362_0069014 3300039453 Bacteria 1232
92 Ga0436362_1167014 3300039453 Bacteria 2436
93 Ga0451577_0636558 3300042876 Bacteria 967
94 Ga0466969_0002995 3300044656 Bacteria 8997
95 Ga0453684_0013005 3300044712 Bacteria 13596
96 Ga0453684_0017394 3300044712 Bacteria 11140
97 Ga0466960_0082359 3300044901 Bacteria 1624
98 Ga0466958_0148657 3300045836 Bacteria 1477
99 Ga0495651_0003356 3300046462 Bacteria 12293
100 Ga0495653_0696703 3300046463 Bacteria 617
101 Ga0495639_0044096 3300046475 Bacteria 2016
102 Ga0495607_0000008 3300046501 Bacteria 265274
103 Ga0495608_0054941 3300046511 Bacteria 2632
104 Ga0495618_0742497 3300046514 Bacteria 575
105 Ga0495628_0296261 3300046516 Bacteria 1198
106 Ga0495630_0383512 3300046517 Bacteria 1077
107 Ga0495665_0419247 3300046531 Bacteria 678
108 Ga0495640_0275840 3300046533 Bacteria 1048
109 Ga0495640_0825046 3300046533 Unclassified 552
110 Ga0495587_0204930 3300046536 Bacteria 1115
111 Ga0495658_0569639 3300046683 Unclassified 725
112 Ga0495680_1085901 3300047322 Bacteria 506
113 Ga0496107_0439794 3300048910 Bacteria 969
114 Ga0496114_0100498 3300048917 Bacteria 2468
115 Ga0496114_0231817 3300048917 Bacteria 1622
116 Ga0496116_0151381 3300048919 Bacteria 1288
117 Ga0496123_0010946 3300048926 Bacteria 7936
118 Ga0501031_0012427 3300049568 Bacteria 5554
119 Ga0501032_0005377 3300049569 Bacteria 9528
120 Ga0501033_0022033 3300049570 Bacteria 4806
121 Ga0501034_0025516 3300049571 Bacteria 6018
122 Ga0501036_0017209 3300049572 Bacteria 6042
123 Ga0501038_0000458 3300049574 Bacteria 35717
124 Ga0501039_0047888 3300049575 Bacteria 3305
125 Ga0501042_0220363 3300049578 Unclassified 1368
126 Ga0501043_0006193 3300049579 Bacteria 9613
127 Ga0501046_0008197 3300049580 Bacteria 9129
128 Ga0501047_0008294 3300049581 Bacteria 9805
129 Ga0501048_0029473 3300049582 Bacteria 3981
130 Ga0501073_0004594 3300049589 Bacteria 10375
131 Ga0501080_0032762 3300049742 Bacteria 4848
132 Ga0501035_0018433 3300049822 Bacteria 6431
133 Ga0501044_0076536 3300049823 Unclassified 3395
134 nmdc:mga0yw44_143124_c1 3300050492 Bacteria 1555
135 nmdc:mga0yw44_395626_c1 3300050492 Bacteria 934
136 nmdc:mga0rr50_33889_c1 3300050513 Bacteria 3652
137 Ga0495612_0370449 3300053078 Bacteria 648
138 Ga0500610_0015135 3300053079 Bacteria 3642
139 Ga0495619_0655080 3300053085 Bacteria 716
140 Ga0500644_0004644 3300053088 Bacteria 3445
141 Ga0500651_0022663 3300053093 Bacteria 3925
142 Ga0500658_0250030 3300053134 Bacteria 815
143 Ga0500559_0010278 3300053136 Unclassified 4022
144 Ga0587111_0076026 3300060346 Bacteria 793
145 Ga0530510_0627371 3300061734 Unclassified 818
146 2514043604 2513237165 Bacteria 6771773
147 2643988051 2643221595 Bacteria 6565519
148 2842918358 2842914999 Bacteria 4419378
149 2881150497 2881147464 Bacteria 7779814
150 2919086992 2919085039 Bacteria 4532964
151 2924767809 2924762789 Bacteria 6561353
152 2965066775 2965062239 Bacteria 7412989
153 8002289563 8002285264 Bacteria 6717907
154 Ga0373945_0032795
155 rootH1_10066339
156 Ga0055535_1000123
157 Ga0055529_1000159
158 Ga0058863_11734117
159 Ga0058861_11892879
160 Ga0058862_10112573
161 Ga0070658_10000096
162 Ga0070658_10000519
163 Ga0070670_100024409
164 Ga0070680_100200220
165 Ga0070709_10069656
166 Ga0070713_101070766
167 Ga0070706_100014913
168 Ga0070706_100589574
169 Ga0070707_100132030
170 Ga0070698_100080253
171 Ga0070699_100224132
172 Ga0070679_100696975
173 Ga0070697_100029688
174 Ga0070697_100467276
175 Ga0068855_100000086
176 Ga0068855_100256897
177 Ga0068858_100765101
178 Ga0075365_10031839
179 Ga0075428_100009880
180 Ga0075431_100019275
181 Ga0105240_10000002
182 Ga0105240_10003040
183 Ga0105240_10004382
184 Ga0105240_11069548
185 Ga0114129_10221149
186 Ga0114129_11066493
187 Ga0105249_10918679
188 Ga0105239_10304861
189 Ga0157370_10000484
190 Ga0157378_10052127
191 Ga0157380_10517980
192 Ga0157376_10005919
193 Ga0213873_10086766
194 Ga0213874_10016801
195 Ga0213876_10194411
196 Ga0209563_108811
197 Ga0209258_100060
198 Ga0209148_1003371
199 Ga0209759_1000282
200 Ga0209129_1000835
201 Ga0209455_1000136
202 Ga0209758_1029974
203 Ga0207699_10722182
204 Ga0207705_10000141
205 Ga0207705_10016217
206 Ga0207684_11004123
207 Ga0207695_10000002
208 Ga0207695_10011071
209 Ga0207695_10016376
210 Ga0207660_10175176
211 Ga0207652_10051877
212 Ga0207652_10634751
213 Ga0207646_10316667
214 Ga0207665_10468673
215 Ga0207667_10000229
216 Ga0265328_10011283
217 Ga0265327_10000499
218 Ga0265316_10502118
219 Ga0307516_10000442
220 Ga0307412_10102143
221 Ga0373923_0512869
222 Ga0373945_0066252
223 Ga0373954_0128336
224 Ga0373955_0031560
225 Ga0373955_0471487
226 Ga0373935_0575330
227 Ga0373927_0012460
228 Ga0373927_0107862
229 Ga0373933_0015219
230 Ga0373933_0569153
231 Ga0373947_0014783
232 Ga0373947_0083237
233 Ga0373947_0098950
234 Ga0373947_0598093
235 Ga0373937_0010746
236 Ga0373937_0435811
237 Ga0373937_0912124
238 Ga0373925_0000163
239 Ga0373925_0162604
240 Ga0436364_0461640
241 Ga0436365_0067640
242 Ga0436363_0434313
243 Ga0436363_1033648
244 Ga0436362_0069014
245 Ga0436362_1167014
246 Ga0451577_0636558
247 Ga0466969_0002995
248 Ga0453684_0013005
249 Ga0453684_0017394
250 Ga0466960_0082359
251 Ga0466958_0148657
252 Ga0495651_0003356
253 Ga0495653_0696703
254 Ga0495639_0044096
255 Ga0495607_0000008
256 Ga0495608_0054941
257 Ga0495618_0742497
258 Ga0495628_0296261
259 Ga0495630_0383512
260 Ga0495665_0419247
261 Ga0495640_0275840
262 Ga0495640_0825046
263 Ga0495587_0204930
264 Ga0495658_0569639
265 Ga0495680_1085901
266 Ga0496107_0439794
267 Ga0496114_0100498
268 Ga0496114_0231817
269 Ga0496116_0151381
270 Ga0496123_0010946
271 Ga0501031_0012427
272 Ga0501032_0005377
273 Ga0501033_0022033
274 Ga0501034_0025516
275 Ga0501036_0017209
276 Ga0501038_0000458
277 Ga0501039_0047888
278 Ga0501042_0220363
279 Ga0501043_0006193
280 Ga0501046_0008197
281 Ga0501047_0008294
282 Ga0501048_0029473
283 Ga0501073_0004594
284 Ga0501080_0032762
285 Ga0501035_0018433
286 Ga0501044_0076536
287 nmdc:mga0yw44_143124_c1
288 nmdc:mga0yw44_395626_c1
289 nmdc:mga0rr50_33889_c1
290 Ga0495612_0370449
291 Ga0500610_0015135
292 Ga0495619_0655080
293 Ga0500644_0004644
294 Ga0500651_0022663
295 Ga0500658_0250030
296 Ga0500559_0010278
297 Ga0587111_0076026
298 Ga0530510_0627371
299 2514043604
300 2643988051
301 2842918358
302 2881150497
303 2919086992
304 2924767809
305 2965066775
306 8002289563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

18

74

0.99

Map