F219024

General Info

Members Datasets Scaffolds Average Seq Length
154 90 153 132

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100697698|Ga0070663_1006976981
Length 160
Sequence MPITLLPMAGTQRAVTVGNTSGNGGSAVMRMHAIQRGFTLIELMIYQNYLIRAQVTEGMSLATGAKAAVWDFVSNTGYFPPSNESAGLAKATSIAGKYVSKVDVTGGAITATFGDDANAAIKVLGKDTLVLSPWTEGGSILWTCKPSTVDPKYLPSSCRN

Samples

Sample ID Description Type Environment
1 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
39 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.3
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.69
Nodule 0
Rhizoplane 0
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10039898 3300002067 Bacteria 1372
2 JGI25156J39149_1015443 3300002705 Bacteria 1524
3 JGI25162J39368_1000550 3300002737 Bacteria 27765
4 JGI25157J39369_1000276 3300002741 Bacteria 37680
5 JGI25157J39369_1000440 3300002741 Bacteria 26544
6 JGI25164J39214_1010009 3300002772 Bacteria 925
7 rootH1_10158794 3300003323 Bacteria 1979
8 Ga0006562J51391_1002302 3300003578 Bacteria 2808
9 Ga0055525_1000093 3300003759 Bacteria 138423
10 Ga0055527_1000045 3300003760 Bacteria 111375
11 Ga0055535_1001899 3300003761 Bacteria 8800
12 Ga0055542_1000303 3300003762 Bacteria 54819
13 Ga0055529_1001783 3300003763 Bacteria 5262
14 Ga0065165_1002161 3300005262 Bacteria 17783
15 Ga0070658_10089342 3300005327 Bacteria 2537
16 Ga0070658_11845195 3300005327 Bacteria 522
17 Ga0070680_101155947 3300005336 Bacteria 669
18 Ga0070660_100060971 3300005339 Bacteria 2929
19 Ga0070660_100082571 3300005339 Bacteria 2523
20 Ga0070660_100271653 3300005339 Bacteria 1386
21 Ga0070661_100251037 3300005344 Bacteria 1365
22 Ga0070659_100000880 3300005366 Bacteria 21954
23 Ga0070659_100001310 3300005366 Bacteria 18022
24 Ga0070659_100012101 3300005366 Bacteria 6389
25 Ga0070659_100015088 3300005366 Bacteria 5778
26 Ga0070659_100015977 3300005366 Bacteria 5629
27 Ga0070659_100058084 3300005366 Bacteria 3052
28 Ga0070713_100029037 3300005436 Bacteria 4374
29 Ga0070711_101717215 3300005439 Bacteria 550
30 Ga0070663_100209754 3300005455 Bacteria 1525
31 Ga0070663_100697698 3300005455 Bacteria 862
32 Ga0070681_10018642 3300005458 Bacteria 6940
33 Ga0070681_10149505 3300005458 Bacteria 2263
34 Ga0070679_101799801 3300005530 Bacteria 561
35 Ga0070696_100663032 3300005546 Bacteria 847
36 Ga0068855_100061941 3300005563 Bacteria 4369
37 Ga0068854_100373959 3300005578 Bacteria 1172
38 Ga0068856_100095307 3300005614 Bacteria 2964
39 Ga0105247_10079463 3300009101 Bacteria 2064
40 Ga0105238_10169083 3300009551 Bacteria 2162
41 Ga0157373_10011982 3300013100 Bacteria 6370
42 Ga0157373_10136746 3300013100 Bacteria 1723
43 Ga0157373_10958630 3300013100 Bacteria 637
44 Ga0157371_10012992 3300013102 Bacteria 6339
45 Ga0157371_10284100 3300013102 Bacteria 1196
46 Ga0157371_10376897 3300013102 Bacteria 1036
47 Ga0157371_10417537 3300013102 Bacteria 983
48 Ga0157371_10490691 3300013102 Bacteria 906
49 Ga0157371_10809896 3300013102 Bacteria 706
50 Ga0157370_10019786 3300013104 Bacteria 6738
51 Ga0157370_10079512 3300013104 Bacteria 3087
52 Ga0157370_10088790 3300013104 Bacteria 2903
53 Ga0157370_10227234 3300013104 Bacteria 1728
54 Ga0157370_10343161 3300013104 Bacteria 1376
55 Ga0157370_10525140 3300013104 Bacteria 1086
56 Ga0157370_10659915 3300013104 Bacteria 956
57 Ga0157370_11033880 3300013104 Bacteria 743
58 Ga0157370_11174269 3300013104 Bacteria 693
59 Ga0157369_10022886 3300013105 Bacteria 6968
60 Ga0157372_10030252 3300013307 Bacteria 5923
61 Ga0157372_10035341 3300013307 Bacteria 5501
62 Ga0157372_10216547 3300013307 Bacteria 2220
63 Ga0157372_10316247 3300013307 Bacteria 1818
64 Ga0182008_10013824 3300014497 Bacteria 4240
65 Ga0182008_10069752 3300014497 Bacteria 1729
66 Ga0182008_10352391 3300014497 Bacteria 781
67 Ga0182007_10073469 3300015262 Bacteria 1120
68 Ga0182007_10093890 3300015262 Bacteria 989
69 Ga0182007_10145076 3300015262 Bacteria 805
70 Ga0182007_10202294 3300015262 Bacteria 695
71 Ga0183369_1013 3300015685 Bacteria 222738
72 Ga0209674_100706 3300025226 Bacteria 11514
73 Ga0209672_100005 3300025228 Bacteria 1069303
74 Ga0209563_100045 3300025230 Bacteria 377102
75 Ga0207427_101468 3300025231 Bacteria 8482
76 Ga0209437_100641 3300025233 Bacteria 20435
77 Ga0209258_100006 3300025242 Bacteria 1069303
78 Ga0209026_1000139 3300025250 Bacteria 115298
79 Ga0209026_1000172 3300025250 Bacteria 98917
80 Ga0209148_1000012 3300025254 Bacteria 1069303
81 Ga0209759_1000479 3300025256 Bacteria 44510
82 Ga0209233_1000532 3300025261 Bacteria 21788
83 Ga0209455_1000008 3300025272 Bacteria 1069303
84 Ga0209758_1106541 3300025297 Bacteria 785
85 Ga0207692_10035703 3300025898 Bacteria 2417
86 Ga0207710_10012775 3300025900 Bacteria 3536
87 Ga0207647_10224437 3300025904 Bacteria 1082
88 Ga0207705_10077092 3300025909 Bacteria 2424
89 Ga0207707_10004801 3300025912 Bacteria 11853
90 Ga0207707_10016237 3300025912 Bacteria 6495
91 Ga0207707_11302344 3300025912 Bacteria 584
92 Ga0207660_10811285 3300025917 Bacteria 764
93 Ga0207657_10071562 3300025919 Bacteria 2936
94 Ga0207657_10100230 3300025919 Bacteria 2405
95 Ga0207657_10251897 3300025919 Bacteria 1407
96 Ga0207657_10519287 3300025919 Bacteria 932
97 Ga0207649_10366965 3300025920 Bacteria 1070
98 Ga0207652_10343444 3300025921 Bacteria 1348
99 Ga0207694_10146721 3300025924 Bacteria 1899
100 Ga0207690_10002413 3300025932 Bacteria 11297
101 Ga0207690_10016225 3300025932 Bacteria 4527
102 Ga0207690_10049835 3300025932 Bacteria 2793
103 Ga0207706_10965964 3300025933 Bacteria 717
104 Ga0207667_10026027 3300025949 Bacteria 6397
105 Ga0207667_10306626 3300025949 Bacteria 1622
106 Ga0207640_10366826 3300025981 Bacteria 1162
107 Ga0395899_0224389 3300037312 Bacteria 1300
108 Ga0395900_0004416 3300037418 Bacteria 14911
109 Ga0395900_0060873 3300037418 Bacteria 3883
110 Ga0395900_0214575 3300037418 Bacteria 1942
111 Ga0395900_1503193 3300037418 Bacteria 585
112 Ga0395898_0000520 3300037466 Bacteria 73491
113 Ga0395898_0000961 3300037466 Bacteria 45890
114 Ga0395898_0001948 3300037466 Bacteria 26115
115 Ga0395898_0314701 3300037466 Bacteria 1493
116 Ga0395898_0803857 3300037466 Bacteria 880
117 Ga0395898_0810115 3300037466 Bacteria 876
118 Ga0395898_1498623 3300037466 Bacteria 600
119 Ga0395901_0000863 3300038443 Bacteria 33387
120 Ga0395901_0002883 3300038443 Bacteria 17357
121 Ga0395901_0006149 3300038443 Bacteria 12163
122 Ga0395901_0022074 3300038443 Bacteria 6522
123 Ga0395901_0031002 3300038443 Bacteria 5511
124 Ga0395901_0562973 3300038443 Bacteria 1154
125 Ga0395901_0883822 3300038443 Bacteria 876
126 Ga0395901_1610557 3300038443 Bacteria 602
127 Ga0450908_004727 3300042184 Bacteria 2622
128 Ga0466966_0052293 3300044684 Bacteria 2595
129 Ga0466961_0000335 3300044693 Bacteria 30912
130 Ga0466961_0207897 3300044693 Unclassified 1209
131 Ga0466964_0000077 3300044706 Bacteria 22114
132 Ga0466970_0000484 3300044765 Bacteria 19601
133 Ga0466958_0340719 3300045836 Bacteria 964
134 Ga0466967_1507284 3300045976 Bacteria 670
135 Ga0495607_0000012 3300046501 Bacteria 195369
136 Ga0501031_0782785 3300049568 Bacteria 612
137 Ga0501032_0520021 3300049569 Bacteria 760
138 Ga0501033_0017348 3300049570 Bacteria 5440
139 Ga0501034_0207279 3300049571 Bacteria 1916
140 Ga0501037_0094881 3300049573 Bacteria 2157
141 Ga0501043_0168856 3300049579 Bacteria 1707
142 Ga0501047_0026021 3300049581 Bacteria 5626
143 Ga0501069_0009063 3300049585 Bacteria 5252
144 Ga0501070_0035747 3300049586 Bacteria 4149
145 Ga0501070_0167547 3300049586 Bacteria 1810
146 Ga0501070_0397939 3300049586 Bacteria 1114
147 Ga0501074_0585845 3300049590 Bacteria 789
148 Ga0501080_0050763 3300049742 Bacteria 3860
149 Ga0501080_0067694 3300049742 Bacteria 3321
150 Ga0501035_0060868 3300049822 Bacteria 3361
151 Ga0501044_0045628 3300049823 Bacteria 4540
152 Ga0501044_0584327 3300049823 Bacteria 1011
153 Ga0587082_004836 3300059504 Bacteria 1717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059504 Ga0587082_004836 Ga0587082_004836_1228_1656 124
2 3300025297 Ga0209758_1106541 Ga0209758_11065412 125
3 3300049590 Ga0501074_0585845 Ga0501074_0585845_19_456 125
4 iso_pu_bacteria 2643221685 2644476222 125
5 3300005262 Ga0065165_1002161 Ga0065165_10021613 126
6 3300005455 Ga0070663_100209754 Ga0070663_1002097543 126
7 3300009101 Ga0105247_10079463 Ga0105247_100794631 127
8 3300013104 Ga0157370_11033880 Ga0157370_110338801 127
9 3300025900 Ga0207710_10012775 Ga0207710_100127751 127
10 3300044693 Ga0466961_0000335 Ga0466961_0000335_15609_16046 127
11 3300044706 Ga0466964_0000077 Ga0466964_0000077_18118_18549 127
12 3300002705 JGI25156J39149_1015443 JGI25156J39149_10154433 128
13 3300002741 JGI25157J39369_1000276 JGI25157J39369_10002766 128
14 3300002741 JGI25157J39369_1000440 JGI25157J39369_10004402 128
15 3300003323 rootH1_10158794 rootH1_101587942 128
16 3300025250 Ga0209026_1000139 Ga0209026_100013987 128
17 3300025250 Ga0209026_1000172 Ga0209026_100017257 128
18 3300025256 Ga0209759_1000479 Ga0209759_100047925 128
19 3300042184 Ga0450908_004727 Ga0450908_004727_1752_2195 128
20 3300046501 Ga0495607_0000012 Ga0495607_0000012_16912_17430 128
21 3300005455 Ga0070663_100697698 Ga0070663_1006976981 129
22 3300005578 Ga0068854_100373959 Ga0068854_1003739591 129
23 3300013104 Ga0157370_10079512 Ga0157370_100795121 129
24 3300013104 Ga0157370_10659915 Ga0157370_106599151 129
25 3300013307 Ga0157372_10216547 Ga0157372_102165472 129
26 3300025919 Ga0207657_10519287 Ga0207657_105192872 129
27 3300025981 Ga0207640_10366826 Ga0207640_103668262 129
28 3300049573 Ga0501037_0094881 Ga0501037_0094881_1656_2099 129
29 3300049585 Ga0501069_0009063 Ga0501069_0009063_2443_2892 129
30 3300049586 Ga0501070_0035747 Ga0501070_0035747_207_650 129
31 3300049586 Ga0501070_0397939 Ga0501070_0397939_424_867 129
32 3300049742 Ga0501080_0067694 Ga0501080_0067694_280_723 129
33 3300002737 JGI25162J39368_1000550 JGI25162J39368_100055022 130
34 3300002772 JGI25164J39214_1010009 JGI25164J39214_10100091 130
35 3300005327 Ga0070658_10089342 Ga0070658_100893421 130
36 3300005327 Ga0070658_11845195 Ga0070658_118451951 130
37 3300005336 Ga0070680_101155947 Ga0070680_1011559471 130
38 3300005339 Ga0070660_100060971 Ga0070660_1000609712 130
39 3300005339 Ga0070660_100082571 Ga0070660_1000825711 130
40 3300005339 Ga0070660_100271653 Ga0070660_1002716531 130
41 3300005344 Ga0070661_100251037 Ga0070661_1002510371 130
42 3300005366 Ga0070659_100000880 Ga0070659_10000088018 130
43 3300005366 Ga0070659_100001310 Ga0070659_1000013105 130
44 3300005366 Ga0070659_100012101 Ga0070659_1000121012 130
45 3300005366 Ga0070659_100015088 Ga0070659_1000150886 130
46 3300005366 Ga0070659_100015977 Ga0070659_1000159775 130
47 3300005366 Ga0070659_100058084 Ga0070659_1000580841 130
48 3300005436 Ga0070713_100029037 Ga0070713_1000290374 130
49 3300005439 Ga0070711_101717215 Ga0070711_1017172151 130
50 3300005458 Ga0070681_10018642 Ga0070681_100186422 130
51 3300005546 Ga0070696_100663032 Ga0070696_1006630322 130
52 3300005563 Ga0068855_100061941 Ga0068855_1000619414 130
53 3300005614 Ga0068856_100095307 Ga0068856_1000953071 130
54 3300009551 Ga0105238_10169083 Ga0105238_101690832 130
55 3300013100 Ga0157373_10011982 Ga0157373_100119825 130
56 3300013100 Ga0157373_10136746 Ga0157373_101367462 130
57 3300013100 Ga0157373_10958630 Ga0157373_109586301 130
58 3300013102 Ga0157371_10012992 Ga0157371_100129924 130
59 3300013102 Ga0157371_10284100 Ga0157371_102841001 130
60 3300013102 Ga0157371_10417537 Ga0157371_104175371 130
61 3300013102 Ga0157371_10490691 Ga0157371_104906912 130
62 3300013102 Ga0157371_10809896 Ga0157371_108098961 130
63 3300013104 Ga0157370_10019786 Ga0157370_100197866 130
64 3300013104 Ga0157370_10088790 Ga0157370_100887901 130
65 3300013104 Ga0157370_10227234 Ga0157370_102272341 130
66 3300013104 Ga0157370_10343161 Ga0157370_103431612 130
67 3300013104 Ga0157370_10525140 Ga0157370_105251402 130
68 3300013104 Ga0157370_11174269 Ga0157370_111742691 130
69 3300013105 Ga0157369_10022886 Ga0157369_100228864 130
70 3300013307 Ga0157372_10030252 Ga0157372_100302523 130
71 3300013307 Ga0157372_10035341 Ga0157372_100353413 130
72 3300013307 Ga0157372_10316247 Ga0157372_103162471 130
73 3300014497 Ga0182008_10013824 Ga0182008_100138245 130
74 3300014497 Ga0182008_10069752 Ga0182008_100697522 130
75 3300014497 Ga0182008_10352391 Ga0182008_103523911 130
76 3300015262 Ga0182007_10073469 Ga0182007_100734692 130
77 3300015262 Ga0182007_10093890 Ga0182007_100938901 130
78 3300015262 Ga0182007_10145076 Ga0182007_101450761 130
79 3300015262 Ga0182007_10202294 Ga0182007_102022941 130
80 3300015685 Ga0183369_1013 Ga0183369_1013168 130
81 3300025226 Ga0209674_100706 Ga0209674_1007063 130
82 3300025231 Ga0207427_101468 Ga0207427_1014683 130
83 3300025233 Ga0209437_100641 Ga0209437_1006413 130
84 3300025261 Ga0209233_1000532 Ga0209233_10005322 130
85 3300025898 Ga0207692_10035703 Ga0207692_100357033 130
86 3300025904 Ga0207647_10224437 Ga0207647_102244372 130
87 3300025909 Ga0207705_10077092 Ga0207705_100770921 130
88 3300025912 Ga0207707_10004801 Ga0207707_100048019 130
89 3300025912 Ga0207707_10016237 Ga0207707_100162373 130
90 3300025912 Ga0207707_11302344 Ga0207707_113023441 130
91 3300025917 Ga0207660_10811285 Ga0207660_108112851 130
92 3300025919 Ga0207657_10071562 Ga0207657_100715624 130
93 3300025919 Ga0207657_10100230 Ga0207657_101002302 130
94 3300025919 Ga0207657_10251897 Ga0207657_102518972 130
95 3300025920 Ga0207649_10366965 Ga0207649_103669652 130
96 3300025921 Ga0207652_10343444 Ga0207652_103434442 130
97 3300025924 Ga0207694_10146721 Ga0207694_101467212 130
98 3300025932 Ga0207690_10002413 Ga0207690_100024135 130
99 3300025932 Ga0207690_10016225 Ga0207690_100162251 130
100 3300025932 Ga0207690_10049835 Ga0207690_100498351 130
101 3300025933 Ga0207706_10965964 Ga0207706_109659641 130
102 3300025949 Ga0207667_10026027 Ga0207667_100260273 130
103 3300025949 Ga0207667_10306626 Ga0207667_103066263 130
104 3300038443 Ga0395901_0562973 Ga0395901_0562973_424_864 130
105 3300045976 Ga0466967_1507284 Ga0466967_1507284_155_598 130
106 3300049568 Ga0501031_0782785 Ga0501031_0782785_136_579 130
107 3300049569 Ga0501032_0520021 Ga0501032_0520021_284_727 130
108 3300049570 Ga0501033_0017348 Ga0501033_0017348_1113_1556 130
109 3300049571 Ga0501034_0207279 Ga0501034_0207279_418_861 130
110 3300049579 Ga0501043_0168856 Ga0501043_0168856_1140_1583 130
111 3300049581 Ga0501047_0026021 Ga0501047_0026021_3989_4432 130
112 3300049586 Ga0501070_0167547 Ga0501070_0167547_797_1234 130
113 3300049742 Ga0501080_0050763 Ga0501080_0050763_279_716 130
114 3300049822 Ga0501035_0060868 Ga0501035_0060868_627_1079 130
115 3300049823 Ga0501044_0045628 Ga0501044_0045628_3219_3662 130
116 3300049823 Ga0501044_0584327 Ga0501044_0584327_529_966 130
117 3300003578 Ga0006562J51391_1002302 Ga0006562J51391_10023022 131
118 3300037418 Ga0395900_0004416 Ga0395900_0004416_14134_14577 131
119 3300037418 Ga0395900_0060873 Ga0395900_0060873_3132_3575 131
120 3300037418 Ga0395900_0214575 Ga0395900_0214575_1401_1844 131
121 3300037418 Ga0395900_1503193 Ga0395900_1503193_90_533 131
122 3300037466 Ga0395898_0000520 Ga0395898_0000520_11660_12103 131
123 3300037466 Ga0395898_0000961 Ga0395898_0000961_12014_12454 131
124 3300037466 Ga0395898_0001948 Ga0395898_0001948_17463_17906 131
125 3300037466 Ga0395898_0314701 Ga0395898_0314701_281_724 131
126 3300037466 Ga0395898_0803857 Ga0395898_0803857_309_752 131
127 3300037466 Ga0395898_0810115 Ga0395898_0810115_277_720 131
128 3300037466 Ga0395898_1498623 Ga0395898_1498623_98_541 131
129 3300038443 Ga0395901_0000863 Ga0395901_0000863_8567_9007 131
130 3300038443 Ga0395901_0002883 Ga0395901_0002883_14134_14577 131
131 3300038443 Ga0395901_0006149 Ga0395901_0006149_4186_4629 131
132 3300038443 Ga0395901_0022074 Ga0395901_0022074_5029_5472 131
133 3300038443 Ga0395901_0031002 Ga0395901_0031002_302_745 131
134 3300038443 Ga0395901_0883822 Ga0395901_0883822_157_600 131
135 3300038443 Ga0395901_1610557 Ga0395901_1610557_71_514 131
136 3300002067 JGI24735J21928_10039898 JGI24735J21928_100398982 132
137 3300003759 Ga0055525_1000093 Ga0055525_100009380 132
138 3300003760 Ga0055527_1000045 Ga0055527_100004544 132
139 3300003761 Ga0055535_1001899 Ga0055535_10018992 132
140 3300003762 Ga0055542_1000303 Ga0055542_100030345 132
141 3300003763 Ga0055529_1001783 Ga0055529_10017832 132
142 3300005458 Ga0070681_10149505 Ga0070681_101495053 132
143 3300005530 Ga0070679_101799801 Ga0070679_1017998011 132
144 3300013102 Ga0157371_10376897 Ga0157371_103768971 132
145 3300025228 Ga0209672_100005 Ga0209672_100005285 132
146 3300025230 Ga0209563_100045 Ga0209563_10004549 132
147 3300025242 Ga0209258_100006 Ga0209258_100006285 132
148 3300025254 Ga0209148_1000012 Ga0209148_1000012285 132
149 3300025272 Ga0209455_1000008 Ga0209455_1000008285 132
150 3300037312 Ga0395899_0224389 Ga0395899_0224389_328_771 132
151 3300044684 Ga0466966_0052293 Ga0466966_0052293_1268_1711 132
152 3300044693 Ga0466961_0207897 Ga0466961_0207897_307_750 132
153 3300044765 Ga0466970_0000484 Ga0466970_0000484_3532_3975 132
154 3300045836 Ga0466958_0340719 Ga0466958_0340719_261_785 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00114

Pilin

Pilin (bacterial filament)

51

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v1j-assembly1.cif.gz_A structure of neisseria meningitidis major pillin 0.9147 18 132
5jw8-assembly1.cif.gz_A crystal structure of the type iv pilin subunit pile from neisseria meningitidis 0.8929 24 132
2hil-assembly1.cif.gz_A structure of the neisseria gonorrhoeae type iv pilus filament from x-ray crystallography and electron cryomicroscopy 0.8883 13 132
1ay2-assembly1.cif.gz_A structure of the fiber-forming protein pilin at 2.6 angstroms resolution 0.838 10 132
5vxx-assembly1.cif.gz_A cryo-em reconstruction of neisseria gonorrhoeae type iv pilus 0.8346 10 132
ID Description Score Start End Superfamily
4xnpA00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8938 24 132 3.30.700.10
1ay2A00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8854 13 132 3.30.700.10
1qveB00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8327 23 132 3.30.700.10
1ay2A00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8041 13 132 3.30.700.10
af_P42522_761_951_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7437 80 116 2.30.29.30
ID Description Score Start End GO Terms
AF-T0YN25-F1-model_v4 Membrane protein containing RDD domain protein 0.986 13 85 GO:0005886
GO:0007155
GO:0009289
AF-A0A8B2WQQ7-F1-model_v4 deleted 0.9762 25 84
AF-T1AIB7-F1-model_v4 Membrane protein containing RDD domain protein 0.9761 13 85 GO:0005886
GO:0007155
GO:0009289
AF-A0A4S3KTW7-F1-model_v4 Pilin 0.9752 13 132 GO:0007155
GO:0009289
GO:0016020
AF-A0A160N2P1-F1-model_v4 GYF domain-containing protein 0.9711 13 132 GO:0007155
GO:0009289
GO:0016020

Feature Viewer

pLDDT pTM Quality
82.69 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map