F219901

General Info

Members Datasets Scaffolds Average Seq Length
154 82 308 487

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1002873|Ga0265337_10028732
Length 551
Sequence MGFAWSLRSHQKFAIFLITGLFPLIVTVSRHRGSGTEIINRIRQRVHARPMAACTAFKLICVDHMSGYFMGKVRTRFAPSPTGFLHVGGLRTALYNYLLAKKEGGEFVLRIEDTDQSRKVDGAVENIVDTLAWAGIRYDEGPGREGDYGPYIQSQRINLYQKYANQLVGEHKAYYCFCSPERLKEVREKQSAAKLTTSYDRHCRNLPQEDVREKLKQGEHHVIRMKVPLDGELTFTDLIRGSVTIAHKVLDDQVILKSDGYPTYHLAVVVDDHFMKITHVIRGEEWLSSTPKHVILFGHFGWEVPQFAHLPLLLNPDKSKLSKRQGDVAVEDYRRKGYLKEALVNFVAFLGWNPGGERELFSLDELSREFSLDRVGNSGAVFNIEKLDWLNFEYLRRKSETELLQNLREQLAASTFDKKDFDDAYLLKVISSMRERVTFVKDFVEKSPYFFQAPVQFDDDVVKKRWKQGSPAQLRELAGQFSRMEHSNKEDFETVLHQTAESMRISNSDLIHPLRLAVSGVGSGPGLFDILFILGKEESVRRINSAIERLR

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
38 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
62 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
63 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
64 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
65 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
66 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
67 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
68 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
69 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
70 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
74 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
75 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
76 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
77 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
82 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 0
Rhizoplane 0.65
Rhizosphere 75.32
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1002873 3300028556 Bacteria 7689
2 Ga0065703_1006039 3300005272 Eukaryota 2454
3 Ga0070676_10000067 3300005328 Bacteria 34841
4 Ga0068869_100000327 3300005334 Bacteria 25274
5 Ga0070680_100051772 3300005336 Bacteria 3351
6 Ga0070667_100000296 3300005367 Bacteria 56013
7 Ga0070667_100000855 3300005367 Bacteria 28369
8 Ga0070667_100044541 3300005367 Bacteria 3727
9 Ga0070714_100000263 3300005435 Bacteria 40794
10 Ga0070706_100001523 3300005467 Bacteria 24256
11 Ga0070665_100001146 3300005548 Bacteria 32578
12 Ga0081455_10011534 3300005937 Bacteria 8871
13 Ga0075365_10000055 3300006038 Bacteria 35554
14 Ga0075368_10012915 3300006042 Bacteria 3061
15 Ga0075363_100000136 3300006048 Bacteria 17837
16 Ga0075364_10041022 3300006051 Bacteria 3004
17 Ga0075367_10000391 3300006178 Bacteria 15960
18 Ga0075369_10000084 3300006186 Bacteria 24811
19 Ga0075370_10001999 3300006353 Bacteria 9250
20 Ga0075430_100006439 3300006846 Bacteria 9898
21 Ga0075429_100005389 3300006880 Bacteria 11007
22 Ga0111539_10026683 3300009094 Bacteria 7059
23 Ga0105242_10040198 3300009176 Bacteria 3768
24 Ga0105239_10000003 3300010375 Bacteria 606801
25 Ga0157378_10056048 3300013297 Unclassified 3511
26 Ga0207645_10000429 3300025907 Bacteria 34807
27 Ga0207684_10000129 3300025910 Bacteria 138143
28 Ga0207664_10000563 3300025929 Bacteria 25989
29 Ga0207689_10003662 3300025942 Bacteria 14016
30 Ga0207658_10000024 3300025986 Bacteria 188273
31 Ga0207658_10003582 3300025986 Bacteria 10968
32 Ga0207658_10032035 3300025986 Bacteria 3738
33 Ga0207675_100181263 3300026118 Bacteria 2017
34 Ga0209966_1000355 3300027695 Bacteria 14029
35 Ga0209813_10006144 3300027866 Bacteria 2953
36 Ga0268266_10003253 3300028379 Bacteria 16371
37 Ga0265337_1008116 3300028556 Bacteria 3853
38 Ga0265326_10002191 3300028558 Bacteria 6619
39 Ga0265326_10002484 3300028558 Bacteria 6210
40 Ga0265326_10003306 3300028558 Bacteria 5313
41 Ga0265326_10004383 3300028558 Bacteria 4527
42 Ga0265319_1000564 3300028563 Bacteria 25122
43 Ga0265319_1003469 3300028563 Bacteria 8207
44 Ga0265334_10000057 3300028573 Bacteria 80027
45 Ga0265334_10010635 3300028573 Bacteria 3884
46 Ga0265334_10013396 3300028573 Bacteria 3435
47 Ga0265334_10030085 3300028573 Bacteria 2174
48 Ga0265318_10003359 3300028577 Bacteria 8085
49 Ga0265318_10024976 3300028577 Bacteria 2364
50 Ga0265322_10000560 3300028654 Bacteria 14245
51 Ga0265322_10002835 3300028654 Bacteria 5296
52 Ga0265322_10008338 3300028654 Bacteria 3019
53 Ga0265336_10000361 3300028666 Bacteria 29382
54 Ga0265338_10000003 3300028800 Bacteria 733923
55 Ga0265338_10000236 3300028800 Bacteria 102289
56 Ga0265338_10003495 3300028800 Bacteria 22046
57 Ga0265338_10006938 3300028800 Bacteria 14248
58 Ga0265338_10012938 3300028800 Bacteria 9472
59 Ga0265338_10018391 3300028800 Bacteria 7482
60 Ga0265338_10030383 3300028800 Bacteria 5324
61 Ga0265338_10174323 3300028800 Bacteria 1646
62 Ga0265324_10001877 3300029957 Bacteria 11311
63 Ga0265324_10009369 3300029957 Bacteria 3828
64 Ga0265330_10001711 3300031235 Bacteria 12386
65 Ga0265330_10010539 3300031235 Bacteria 4354
66 Ga0265332_10001054 3300031238 Bacteria 16174
67 Ga0265320_10007982 3300031240 Bacteria 6517
68 Ga0265320_10039455 3300031240 Bacteria 2361
69 Ga0265325_10008894 3300031241 Bacteria 5900
70 Ga0265325_10023086 3300031241 Bacteria 3402
71 Ga0265325_10024351 3300031241 Bacteria 3295
72 Ga0265329_10005476 3300031242 Bacteria 5125
73 Ga0265329_10015567 3300031242 Bacteria 2655
74 Ga0265340_10015983 3300031247 Bacteria 3891
75 Ga0265340_10016547 3300031247 Bacteria 3819
76 Ga0265339_10001996 3300031249 Bacteria 14992
77 Ga0265331_10004834 3300031250 Bacteria 8297
78 Ga0265331_10005802 3300031250 Bacteria 7397
79 Ga0265316_10006838 3300031344 Bacteria 10836
80 Ga0265316_10009090 3300031344 Bacteria 9155
81 Ga0265316_10065215 3300031344 Bacteria 2820
82 Ga0265316_10096402 3300031344 Unclassified 2252
83 Ga0265313_10021768 3300031595 Bacteria 3497
84 Ga0265314_10003477 3300031711 Bacteria 15211
85 Ga0265342_10001466 3300031712 Bacteria 21949
86 Ga0265342_10002665 3300031712 Bacteria 15227
87 Ga0265342_10003199 3300031712 Bacteria 13617
88 Ga0265342_10027080 3300031712 Bacteria 3588
89 Ga0307410_10000309 3300031852 Bacteria 19091
90 Ga0307411_10000151 3300032005 Bacteria 22012
91 Ga0316584_0147022 3300036712 Bacteria 1756
92 Ga0395905_0020202 3300037471 Bacteria 6310
93 Ga0400483_234863 3300039062 Bacteria 12666
94 Ga0451577_0000003 3300042876 Bacteria 921850
95 Ga0451577_0000007 3300042876 Bacteria 694123
96 Ga0451577_0000202 3300042876 Bacteria 124050
97 Ga0451577_0000244 3300042876 Bacteria 106944
98 Ga0451577_0004211 3300042876 Bacteria 15341
99 Ga0451577_0177858 3300042876 Bacteria 1918
100 Ga0453684_0000004 3300044712 Bacteria 1469893
101 Ga0453684_0000011 3300044712 Bacteria 1108399
102 Ga0453684_0000018 3300044712 Bacteria 921850
103 Ga0453684_0000036 3300044712 Bacteria 711481
104 Ga0453684_0000042 3300044712 Bacteria 682980
105 Ga0453684_0000141 3300044712 Bacteria 316572
106 Ga0453684_0000146 3300044712 Bacteria 312006
107 Ga0453684_0009317 3300044712 Bacteria 17227
108 Ga0453684_0025085 3300044712 Bacteria 8674
109 Ga0453684_0031325 3300044712 Bacteria 7479
110 Ga0453684_0042336 3300044712 Bacteria 6141
111 Ga0453684_0091659 3300044712 Bacteria 3751
112 Ga0453684_0126684 3300044712 Unclassified 3072
113 Ga0453684_0345084 3300044712 Bacteria 1680
114 Ga0451576_0001011 3300045051 Bacteria 51991
115 Ga0451576_0003554 3300045051 Bacteria 21229
116 Ga0451576_0008184 3300045051 Bacteria 12312
117 Ga0451576_0022694 3300045051 Bacteria 6799
118 Ga0451576_0147880 3300045051 Bacteria 2450
119 Ga0496103_0019713 3300048906 Bacteria 4048
120 Ga0496116_0003053 3300048919 Bacteria 16914
121 Ga0496116_0017216 3300048919 Bacteria 5620
122 Ga0496116_0025504 3300048919 Bacteria 4344
123 Ga0496117_0000374 3300048920 Bacteria 77253
124 Ga0496119_0000033 3300048922 Bacteria 218976
125 Ga0496120_0000171 3300048923 Bacteria 110335
126 Ga0496120_0003377 3300048923 Bacteria 14612
127 Ga0496120_0004952 3300048923 Bacteria 10820
128 Ga0496122_0000015 3300048925 Bacteria 489028
129 Ga0496122_0000599 3300048925 Bacteria 74168
130 Ga0496122_0000617 3300048925 Bacteria 73024
131 Ga0496123_0000193 3300048926 Bacteria 123847
132 Ga0496123_0011225 3300048926 Bacteria 7792
133 Ga0496123_0021666 3300048926 Bacteria 4986
134 Ga0496124_0157727 3300048927 Unclassified 1773
135 Ga0496125_0000043 3300048928 Bacteria 301512
136 Ga0496126_0000076 3300048929 Bacteria 234420
137 Ga0496126_0000537 3300048929 Bacteria 73312
138 Ga0496126_0000887 3300048929 Bacteria 52527
139 Ga0496126_0004426 3300048929 Bacteria 16817
140 Ga0501034_0030902 3300049571 Bacteria 5443
141 Ga0501034_0282141 3300049571 Bacteria 1600
142 Ga0501083_0000013 3300049744 Bacteria 178063
143 Ga0501083_0000044 3300049744 Bacteria 91900
144 nmdc:mga03n38_86_c1 3300050490 Bacteria 20120
145 nmdc:mga00v17_239_c1 3300050491 Bacteria 32689
146 nmdc:mga00v17_461_c1 3300050491 Bacteria 22760
147 nmdc:mga0yw44_30_c1 3300050492 Bacteria 35526
148 nmdc:mga06z11_220_c1 3300050494 Bacteria 22832
149 nmdc:mga07m45_207_c1 3300050496 Bacteria 23031
150 nmdc:mga09592_4741_c1 3300050508 Bacteria 11017
151 nmdc:mga0qj67_15852_c1 3300050509 Bacteria 5707
152 nmdc:mga08y16_30350_c1 3300050511 Bacteria 5690
153 nmdc:mga0sz30_29_c2 3300050516 Bacteria 56201
154 Ga0500616_0000098 3300053153 Bacteria 177051
155 Ga0265337_1002873
156 Ga0065703_1006039
157 Ga0070676_10000067
158 Ga0068869_100000327
159 Ga0070680_100051772
160 Ga0070667_100000296
161 Ga0070667_100000855
162 Ga0070667_100044541
163 Ga0070714_100000263
164 Ga0070706_100001523
165 Ga0070665_100001146
166 Ga0081455_10011534
167 Ga0075365_10000055
168 Ga0075368_10012915
169 Ga0075363_100000136
170 Ga0075364_10041022
171 Ga0075367_10000391
172 Ga0075369_10000084
173 Ga0075370_10001999
174 Ga0075430_100006439
175 Ga0075429_100005389
176 Ga0111539_10026683
177 Ga0105242_10040198
178 Ga0105239_10000003
179 Ga0157378_10056048
180 Ga0207645_10000429
181 Ga0207684_10000129
182 Ga0207664_10000563
183 Ga0207689_10003662
184 Ga0207658_10000024
185 Ga0207658_10003582
186 Ga0207658_10032035
187 Ga0207675_100181263
188 Ga0209966_1000355
189 Ga0209813_10006144
190 Ga0268266_10003253
191 Ga0265337_1008116
192 Ga0265326_10002191
193 Ga0265326_10002484
194 Ga0265326_10003306
195 Ga0265326_10004383
196 Ga0265319_1000564
197 Ga0265319_1003469
198 Ga0265334_10000057
199 Ga0265334_10010635
200 Ga0265334_10013396
201 Ga0265334_10030085
202 Ga0265318_10003359
203 Ga0265318_10024976
204 Ga0265322_10000560
205 Ga0265322_10002835
206 Ga0265322_10008338
207 Ga0265336_10000361
208 Ga0265338_10000003
209 Ga0265338_10000236
210 Ga0265338_10003495
211 Ga0265338_10006938
212 Ga0265338_10012938
213 Ga0265338_10018391
214 Ga0265338_10030383
215 Ga0265338_10174323
216 Ga0265324_10001877
217 Ga0265324_10009369
218 Ga0265330_10001711
219 Ga0265330_10010539
220 Ga0265332_10001054
221 Ga0265320_10007982
222 Ga0265320_10039455
223 Ga0265325_10008894
224 Ga0265325_10023086
225 Ga0265325_10024351
226 Ga0265329_10005476
227 Ga0265329_10015567
228 Ga0265340_10015983
229 Ga0265340_10016547
230 Ga0265339_10001996
231 Ga0265331_10004834
232 Ga0265331_10005802
233 Ga0265316_10006838
234 Ga0265316_10009090
235 Ga0265316_10065215
236 Ga0265316_10096402
237 Ga0265313_10021768
238 Ga0265314_10003477
239 Ga0265342_10001466
240 Ga0265342_10002665
241 Ga0265342_10003199
242 Ga0265342_10027080
243 Ga0307410_10000309
244 Ga0307411_10000151
245 Ga0316584_0147022
246 Ga0395905_0020202
247 Ga0400483_234863
248 Ga0451577_0000003
249 Ga0451577_0000007
250 Ga0451577_0000202
251 Ga0451577_0000244
252 Ga0451577_0004211
253 Ga0451577_0177858
254 Ga0453684_0000004
255 Ga0453684_0000011
256 Ga0453684_0000018
257 Ga0453684_0000036
258 Ga0453684_0000042
259 Ga0453684_0000141
260 Ga0453684_0000146
261 Ga0453684_0009317
262 Ga0453684_0025085
263 Ga0453684_0031325
264 Ga0453684_0042336
265 Ga0453684_0091659
266 Ga0453684_0126684
267 Ga0453684_0345084
268 Ga0451576_0001011
269 Ga0451576_0003554
270 Ga0451576_0008184
271 Ga0451576_0022694
272 Ga0451576_0147880
273 Ga0496103_0019713
274 Ga0496116_0003053
275 Ga0496116_0017216
276 Ga0496116_0025504
277 Ga0496117_0000374
278 Ga0496119_0000033
279 Ga0496120_0000171
280 Ga0496120_0003377
281 Ga0496120_0004952
282 Ga0496122_0000015
283 Ga0496122_0000599
284 Ga0496122_0000617
285 Ga0496123_0000193
286 Ga0496123_0011225
287 Ga0496123_0021666
288 Ga0496124_0157727
289 Ga0496125_0000043
290 Ga0496126_0000076
291 Ga0496126_0000537
292 Ga0496126_0000887
293 Ga0496126_0004426
294 Ga0501034_0030902
295 Ga0501034_0282141
296 Ga0501083_0000013
297 Ga0501083_0000044
298 nmdc:mga03n38_86_c1
299 nmdc:mga00v17_239_c1
300 nmdc:mga00v17_461_c1
301 nmdc:mga0yw44_30_c1
302 nmdc:mga06z11_220_c1
303 nmdc:mga07m45_207_c1
304 nmdc:mga09592_4741_c1
305 nmdc:mga0qj67_15852_c1
306 nmdc:mga08y16_30350_c1
307 nmdc:mga0sz30_29_c2
308 Ga0500616_0000098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

72

389

0.99

PF19269

Anticodon_2

Anticodon binding domain

401

547

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k86-assembly1.cif.gz_A crystal structure of glutamyl-trna synthetase (gltx) from stenotrophomonas maltophilia 0.849 65 596
5h4v-assembly5.cif.gz_E structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae 0.8472 66 596
7k86-assembly2.cif.gz_B crystal structure of glutamyl-trna synthetase (gltx) from stenotrophomonas maltophilia 0.8386 65 596
8i9i-assembly1.cif.gz_B glutamyl-trna synthetase from escherichia coli bound to glutamate and zinc 0.8383 65 596
7k86-assembly1.cif.gz_A crystal structure of glutamyl-trna synthetase (gltx) from stenotrophomonas maltophilia 0.8333 65 596
ID Description Score Start End Superfamily
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.979 66 317 3.40.50.620
4a91A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9585 64 133 3.40.50.620
3akzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9316 66 317 3.40.50.620
5tgtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9309 64 400 3.40.50.620
af_Q8IDD3_74_404_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9106 66 407 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A0U2Q651-F1-model_v4 GltX_bact: glutamate--tRNA 1.002 64 164 GO:0004818
GO:0005524
GO:0006424
AF-A0A356B4W8-F1-model_v4 Glutamate--tRNA ligase 0.9975 66 149 GO:0004818
GO:0005524
GO:0006424
AF-A0A520A1M2-F1-model_v4 Glutamate--tRNA ligase 0.9939 66 174 GO:0004818
GO:0005524
GO:0006424
AF-A0A4Q5QKL4-F1-model_v4 Glutamate--tRNA ligase 0.9834 65 174 GO:0004818
GO:0005524
GO:0005829
GO:0006424
AF-A0A7W1J8X8-F1-model_v4 Glutamate--tRNA ligase 0.9798 66 171 GO:0004818
GO:0005524
GO:0005829
GO:0006424

Map