F219902

General Info

Members Datasets Scaffolds Average Seq Length
154 82 308 275

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10006399|Ga0265326_100063993
Length 271
Sequence MTISSTGVKSRDSRRSIGDLLVPLNELATRSVNLVANHEAHFEIEGETYNFPRYLFIGSVSGEAPIRVGIFATIHGDEPEGAHAIAQFIEALEGRPEFAAGYYLSFYPLCNPTGYEDNTSHSRNGSDLDREFWKNSKQPEVQLLQAELVSQSFQGIISLRTDATSDGFYALVRGGGTLAKHLVEPSLRAVDEFLPRDSRLLIDGLRSRDGIVRDEPDGRLSAPPKVRPRPFEIVLTTPKAPPAFLKESALIVALQTILAEYRRFIAHAQNI

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
33 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
34 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
35 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
36 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
45 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
46 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
47 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
50 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
51 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
52 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 12.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10006399 3300028558 Bacteria 3663
2 rootH2_10019876 3300003320 Bacteria 6087
3 rootH1_10075784 3300003323 Bacteria 2739
4 Ga0070714_100321914 3300005435 Bacteria 1446
5 Ga0070713_100158466 3300005436 Unclassified 2019
6 Ga0070686_100022684 3300005544 Unclassified 3743
7 Ga0068857_100054229 3300005577 Bacteria 3557
8 Ga0068857_100112914 3300005577 Bacteria 2443
9 Ga0068856_100000211 3300005614 Bacteria 63015
10 Ga0070702_100055235 3300005615 Bacteria 2289
11 Ga0068859_100010527 3300005617 Bacteria 9308
12 Ga0068863_100037746 3300005841 Bacteria 4597
13 Ga0068862_100611605 3300005844 Bacteria 1047
14 Ga0070715_10046507 3300006163 Bacteria 1845
15 Ga0097620_100010527 3300006931 Bacteria 9308
16 Ga0105240_10014331 3300009093 Bacteria 10829
17 Ga0105245_10195350 3300009098 Bacteria 1941
18 Ga0105247_10412176 3300009101 Unclassified 965
19 Ga0105238_10038127 3300009551 Bacteria 4882
20 Ga0105238_10208255 3300009551 Bacteria 1931
21 Ga0207695_10230390 3300025913 Bacteria 1757
22 Ga0207695_10254247 3300025913 Unclassified 1656
23 Ga0207694_10003518 3300025924 Bacteria 12431
24 Ga0207667_10024961 3300025949 Bacteria 6553
25 Ga0207702_10002640 3300026078 Bacteria 16839
26 Ga0207702_10063538 3300026078 Bacteria 3157
27 Ga0207641_10086040 3300026088 Bacteria 2740
28 Ga0207674_10049705 3300026116 Bacteria 4287
29 Ga0268265_10712255 3300028380 Unclassified 971
30 Ga0265337_1000036 3300028556 Bacteria 58197
31 Ga0265337_1000774 3300028556 Bacteria 16879
32 Ga0265337_1003794 3300028556 Bacteria 6440
33 Ga0265337_1009704 3300028556 Bacteria 3420
34 Ga0265337_1010477 3300028556 Bacteria 3245
35 Ga0265337_1055611 3300028556 Unclassified 1105
36 Ga0265337_1064264 3300028556 Unclassified 1013
37 Ga0265326_10013506 3300028558 Bacteria 2388
38 Ga0265326_10024556 3300028558 Bacteria 1720
39 Ga0265319_1000019 3300028563 Bacteria 154537
40 Ga0265319_1009200 3300028563 Bacteria 4233
41 Ga0265319_1072553 3300028563 Bacteria 1102
42 Ga0265323_10001439 3300028653 Bacteria 11698
43 Ga0265323_10006091 3300028653 Bacteria 5090
44 Ga0265323_10036552 3300028653 Bacteria 1804
45 Ga0265323_10038340 3300028653 Bacteria 1752
46 Ga0265322_10045560 3300028654 Bacteria 1248
47 Ga0265336_10001074 3300028666 Bacteria 13279
48 Ga0265336_10019844 3300028666 Bacteria 2165
49 Ga0265336_10021297 3300028666 Bacteria 2073
50 Ga0265336_10028166 3300028666 Bacteria 1756
51 Ga0265336_10045576 3300028666 Bacteria 1333
52 Ga0265338_10000129 3300028800 Bacteria 138608
53 Ga0265338_10000593 3300028800 Bacteria 63891
54 Ga0265338_10000834 3300028800 Bacteria 51995
55 Ga0265338_10001094 3300028800 Bacteria 45068
56 Ga0265338_10001418 3300028800 Bacteria 39001
57 Ga0265338_10001689 3300028800 Bacteria 35059
58 Ga0265338_10004656 3300028800 Bacteria 18429
59 Ga0265338_10005377 3300028800 Bacteria 16734
60 Ga0265338_10008372 3300028800 Bacteria 12566
61 Ga0265338_10008501 3300028800 Bacteria 12450
62 Ga0265338_10011960 3300028800 Bacteria 9944
63 Ga0265338_10020307 3300028800 Bacteria 6999
64 Ga0265338_10022827 3300028800 Bacteria 6457
65 Ga0265338_10034387 3300028800 Bacteria 4900
66 Ga0265338_10035736 3300028800 Bacteria 4767
67 Ga0265338_10056004 3300028800 Bacteria 3501
68 Ga0265338_10122982 3300028800 Bacteria 2064
69 Ga0265324_10012770 3300029957 Bacteria 3156
70 Ga0265324_10022445 3300029957 Bacteria 2255
71 Ga0265324_10046050 3300029957 Unclassified 1501
72 Ga0265324_10046734 3300029957 Bacteria 1489
73 Ga0265328_10006716 3300031239 Bacteria 4845
74 Ga0265320_10001037 3300031240 Bacteria 20637
75 Ga0265320_10004500 3300031240 Bacteria 9124
76 Ga0265320_10019515 3300031240 Bacteria 3704
77 Ga0265320_10026767 3300031240 Bacteria 3014
78 Ga0265320_10052831 3300031240 Bacteria 1965
79 Ga0265325_10014207 3300031241 Bacteria 4507
80 Ga0265325_10036091 3300031241 Bacteria 2621
81 Ga0265325_10091141 3300031241 Bacteria 1503
82 Ga0265329_10002590 3300031242 Bacteria 8158
83 Ga0265340_10005220 3300031247 Bacteria 7211
84 Ga0265340_10014640 3300031247 Bacteria 4091
85 Ga0265339_10002641 3300031249 Bacteria 12778
86 Ga0265339_10049203 3300031249 Bacteria 2310
87 Ga0265327_10006883 3300031251 Bacteria 8943
88 Ga0265327_10033732 3300031251 Bacteria 2848
89 Ga0265327_10085231 3300031251 Bacteria 1551
90 Ga0265316_10002751 3300031344 Bacteria 18013
91 Ga0265316_10018450 3300031344 Bacteria 5994
92 Ga0265316_10024926 3300031344 Bacteria 5000
93 Ga0265316_10045680 3300031344 Bacteria 3475
94 Ga0265316_10064141 3300031344 Bacteria 2846
95 Ga0265316_10092212 3300031344 Bacteria 2310
96 Ga0265316_10113394 3300031344 Unclassified 2051
97 Ga0265316_10183025 3300031344 Bacteria 1559
98 Ga0265316_10268685 3300031344 Unclassified 1249
99 Ga0265313_10002888 3300031595 Bacteria 14389
100 Ga0265313_10003159 3300031595 Bacteria 13599
101 Ga0265314_10001317 3300031711 Bacteria 28131
102 Ga0265314_10016036 3300031711 Bacteria 5932
103 Ga0265314_10253365 3300031711 Bacteria 1009
104 Ga0265342_10041127 3300031712 Bacteria 2801
105 Ga0265342_10106437 3300031712 Bacteria 1592
106 Ga0373930_0003343 3300034816 Bacteria 2537
107 Ga0373926_0069194 3300035083 Unclassified 1295
108 Ga0373928_0000434 3300035084 Bacteria 8324
109 Ga0373929_0000709 3300035085 Bacteria 6461
110 Ga0373944_0000471 3300035089 Bacteria 9348
111 Ga0373949_0001831 3300035090 Bacteria 5796
112 Ga0373951_0025203 3300035091 Bacteria 1380
113 Ga0373932_0000006 3300035112 Bacteria 208547
114 Ga0373945_0021006 3300035116 Bacteria 2240
115 Ga0373945_0038997 3300035116 Bacteria 1711
116 Ga0373956_0101562 3300035119 Bacteria 1334
117 Ga0373957_0101563 3300035120 Unclassified 1152
118 Ga0373957_0170752 3300035120 Unclassified 899
119 Ga0373943_0013543 3300035170 Bacteria 3684
120 Ga0373931_0000009 3300035691 Bacteria 349854
121 Ga0373935_0170291 3300035692 Bacteria 1489
122 Ga0373927_0078933 3300035695 Unclassified 2132
123 Ga0373933_0324506 3300035724 Unclassified 998
124 Ga0373937_0074024 3300036401 Bacteria 3142
125 Ga0373937_0129849 3300036401 Bacteria 2353
126 Ga0373937_0139223 3300036401 Unclassified 2270
127 Ga0373925_0000301 3300037068 Bacteria 51799
128 Ga0373925_0007483 3300037068 Bacteria 7967
129 Ga0451577_0256162 3300042876 Bacteria 1584
130 Ga0453684_0000192 3300044712 Bacteria 266757
131 Ga0453684_0001999 3300044712 Bacteria 52205
132 Ga0495629_0350839 3300046459 Unclassified 1006
133 Ga0495608_0089051 3300046511 Bacteria 1998
134 Ga0495618_0022942 3300046514 Bacteria 3855
135 Ga0495630_0177821 3300046517 Bacteria 1622
136 Ga0495640_0126257 3300046533 Bacteria 1659
137 Ga0495586_0001244 3300046535 Bacteria 14299
138 Ga0495634_0084025 3300046642 Bacteria 2077
139 Ga0495634_0258702 3300046642 Bacteria 1063
140 Ga0495635_0175543 3300046663 Bacteria 1457
141 Ga0495635_0306547 3300046663 Unclassified 1064
142 Ga0495613_0280336 3300046689 Bacteria 1158
143 Ga0495680_0126860 3300047322 Bacteria 1878
144 Ga0495675_0322564 3300047444 Bacteria 913
145 Ga0501031_0000091 3300049568 Bacteria 48610
146 Ga0501032_0185390 3300049569 Bacteria 1361
147 Ga0501033_0021218 3300049570 Bacteria 4900
148 Ga0501043_0512501 3300049579 Unclassified 895
149 Ga0501080_0075822 3300049742 Bacteria 3128
150 Ga0501035_0028462 3300049822 Bacteria 5099
151 Ga0501035_0118970 3300049822 Bacteria 2311
152 Ga0501044_0000810 3300049823 Bacteria 37615
153 Ga0501044_0423435 3300049823 Unclassified 1241
154 Ga0500650_0004562 3300053098 Bacteria 5026
155 Ga0265326_10006399
156 rootH2_10019876
157 rootH1_10075784
158 Ga0070714_100321914
159 Ga0070713_100158466
160 Ga0070686_100022684
161 Ga0068857_100054229
162 Ga0068857_100112914
163 Ga0068856_100000211
164 Ga0070702_100055235
165 Ga0068859_100010527
166 Ga0068863_100037746
167 Ga0068862_100611605
168 Ga0070715_10046507
169 Ga0097620_100010527
170 Ga0105240_10014331
171 Ga0105245_10195350
172 Ga0105247_10412176
173 Ga0105238_10038127
174 Ga0105238_10208255
175 Ga0207695_10230390
176 Ga0207695_10254247
177 Ga0207694_10003518
178 Ga0207667_10024961
179 Ga0207702_10002640
180 Ga0207702_10063538
181 Ga0207641_10086040
182 Ga0207674_10049705
183 Ga0268265_10712255
184 Ga0265337_1000036
185 Ga0265337_1000774
186 Ga0265337_1003794
187 Ga0265337_1009704
188 Ga0265337_1010477
189 Ga0265337_1055611
190 Ga0265337_1064264
191 Ga0265326_10013506
192 Ga0265326_10024556
193 Ga0265319_1000019
194 Ga0265319_1009200
195 Ga0265319_1072553
196 Ga0265323_10001439
197 Ga0265323_10006091
198 Ga0265323_10036552
199 Ga0265323_10038340
200 Ga0265322_10045560
201 Ga0265336_10001074
202 Ga0265336_10019844
203 Ga0265336_10021297
204 Ga0265336_10028166
205 Ga0265336_10045576
206 Ga0265338_10000129
207 Ga0265338_10000593
208 Ga0265338_10000834
209 Ga0265338_10001094
210 Ga0265338_10001418
211 Ga0265338_10001689
212 Ga0265338_10004656
213 Ga0265338_10005377
214 Ga0265338_10008372
215 Ga0265338_10008501
216 Ga0265338_10011960
217 Ga0265338_10020307
218 Ga0265338_10022827
219 Ga0265338_10034387
220 Ga0265338_10035736
221 Ga0265338_10056004
222 Ga0265338_10122982
223 Ga0265324_10012770
224 Ga0265324_10022445
225 Ga0265324_10046050
226 Ga0265324_10046734
227 Ga0265328_10006716
228 Ga0265320_10001037
229 Ga0265320_10004500
230 Ga0265320_10019515
231 Ga0265320_10026767
232 Ga0265320_10052831
233 Ga0265325_10014207
234 Ga0265325_10036091
235 Ga0265325_10091141
236 Ga0265329_10002590
237 Ga0265340_10005220
238 Ga0265340_10014640
239 Ga0265339_10002641
240 Ga0265339_10049203
241 Ga0265327_10006883
242 Ga0265327_10033732
243 Ga0265327_10085231
244 Ga0265316_10002751
245 Ga0265316_10018450
246 Ga0265316_10024926
247 Ga0265316_10045680
248 Ga0265316_10064141
249 Ga0265316_10092212
250 Ga0265316_10113394
251 Ga0265316_10183025
252 Ga0265316_10268685
253 Ga0265313_10002888
254 Ga0265313_10003159
255 Ga0265314_10001317
256 Ga0265314_10016036
257 Ga0265314_10253365
258 Ga0265342_10041127
259 Ga0265342_10106437
260 Ga0373930_0003343
261 Ga0373926_0069194
262 Ga0373928_0000434
263 Ga0373929_0000709
264 Ga0373944_0000471
265 Ga0373949_0001831
266 Ga0373951_0025203
267 Ga0373932_0000006
268 Ga0373945_0021006
269 Ga0373945_0038997
270 Ga0373956_0101562
271 Ga0373957_0101563
272 Ga0373957_0170752
273 Ga0373943_0013543
274 Ga0373931_0000009
275 Ga0373935_0170291
276 Ga0373927_0078933
277 Ga0373933_0324506
278 Ga0373937_0074024
279 Ga0373937_0129849
280 Ga0373937_0139223
281 Ga0373925_0000301
282 Ga0373925_0007483
283 Ga0451577_0256162
284 Ga0453684_0000192
285 Ga0453684_0001999
286 Ga0495629_0350839
287 Ga0495608_0089051
288 Ga0495618_0022942
289 Ga0495630_0177821
290 Ga0495640_0126257
291 Ga0495586_0001244
292 Ga0495634_0084025
293 Ga0495634_0258702
294 Ga0495635_0175543
295 Ga0495635_0306547
296 Ga0495613_0280336
297 Ga0495680_0126860
298 Ga0495675_0322564
299 Ga0501031_0000091
300 Ga0501032_0185390
301 Ga0501033_0021218
302 Ga0501043_0512501
303 Ga0501080_0075822
304 Ga0501035_0028462
305 Ga0501035_0118970
306 Ga0501044_0000810
307 Ga0501044_0423435
308 Ga0500650_0004562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b2y-assembly2.cif.gz_B crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.8435 21 263
3b2y-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution 0.8412 21 263
2qvp-assembly1.cif.gz_A crystal structure of a putative metallopeptidase (sama_0725) from shewanella amazonensis sb2b at 2.00 a resolution 0.8274 21 263
3ieh-assembly1.cif.gz_A crystal structure of putative metallopeptidase (yp_001051774.1) from shewanella baltica os155 at 2.45 a resolution 0.8197 21 263
4oko-assembly4.cif.gz_D crystal structure of francisella tularensis rep34 (rapid encystment phenotype protein 34 kda) 0.8071 14 267
ID Description Score Start End Superfamily
3b2yB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8271 21 264 3.40.630.10
4okoC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8066 14 266 3.40.630.10
af_A0A0P0WSN8_58_197_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7832 17 143 3.40.630.10
af_I1NH52_71_347_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7572 17 263 3.40.630.10
af_E7F254_893_1182_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7547 20 266 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V5QJH1-F1-model_v4 Peptidase M14 0.9728 73 216 GO:0016788
GO:0046872
AF-A0A6N6QA65-F1-model_v4 M14 family metallocarboxypeptidase 0.9726 39 275 GO:0004180
GO:0016788
GO:0046872
AF-A0A290QIM9-F1-model_v4 Peptidase M14 0.965 17 275 GO:0016788
GO:0046872
AF-A0A6N6QA65-F1-model_v4 M14 family metallocarboxypeptidase 0.9646 39 275 GO:0004180
GO:0016788
GO:0046872
AF-A0A4Q2XZ68-F1-model_v4 Peptidase M14 carboxypeptidase A domain-containing protein 0.9642 19 275 GO:0016788
GO:0046872

Map