F220185

General Info

Members Datasets Scaffolds Average Seq Length
154 122 308 174

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0326358|Ga0436364_0326358_589_1179
Length 196
Sequence MSSDFSIQLGLAHLQLLKGDITRIKVDAIVNAANSALAGGGGVDGAIHRAGGPEIMRELDAIRERDGGCATGNAVVTGAGLLPAKYVLHAVGPRYRDGSHGERELLTSCYIVCLQLAAERDVKTISFPSISTGIYGYPIEQAAEIAVRTTAGWLREHRGPVHTVKLVQFSDADHEVYRRHAQSLRGTLAAGITAKM

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
102 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
103 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
104 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
105 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
106 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
107 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
116 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
118 2904456579 Variovorax sp. 2002 Isolate Unclassified
119 2914759650 Rhizosphaericola mali Isolate Rhizosphere
120 2929520902 Variovorax beijingensis 502 Isolate Unclassified
121 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
122 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.65
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.78
Nodule 0
Rhizoplane 0.65
Rhizosphere 73.38
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0326358 3300037853 Bacteria 1310
2 JGI25152J39213_1005497 3300002773 Bacteria 3674
3 JGI25406J46586_10004645 3300003203 Bacteria 6393
4 JGI25153J46596_10000405 3300003215 Bacteria 28717
5 Ga0055535_1000047 3300003761 Bacteria 139836
6 Ga0055529_1000148 3300003763 Bacteria 100809
7 Ga0055526_1004403 3300003771 Bacteria 8477
8 Ga0055530_10005848 3300003791 Bacteria 5697
9 Ga0055540_1011028 3300003792 Bacteria 2952
10 Ga0065165_1005989 3300005262 Bacteria 6560
11 Ga0070658_10099455 3300005327 Bacteria 2403
12 Ga0070658_10107958 3300005327 Bacteria 2303
13 Ga0070658_10177398 3300005327 Bacteria 1792
14 Ga0070683_100808405 3300005329 Bacteria 899
15 Ga0070670_100076409 3300005331 Bacteria 2877
16 Ga0070680_100852624 3300005336 Bacteria 785
17 Ga0070660_100995750 3300005339 Bacteria 708
18 Ga0070661_100676938 3300005344 Bacteria 839
19 Ga0070713_100008578 3300005436 Bacteria 7257
20 Ga0070711_100104903 3300005439 Bacteria 2063
21 Ga0070700_100016953 3300005441 Bacteria 4158
22 Ga0070694_100176534 3300005444 Bacteria 1577
23 Ga0070665_100767048 3300005548 Bacteria 977
24 Ga0070704_100310574 3300005549 Bacteria 1317
25 Ga0070664_100065301 3300005564 Bacteria 3105
26 Ga0068861_100000529 3300005719 Bacteria 22393
27 Ga0081538_10004614 3300005981 Bacteria 12655
28 Ga0081538_10018570 3300005981 Bacteria 5214
29 Ga0081538_10038037 3300005981 Bacteria 3111
30 Ga0081539_10010991 3300005985 Bacteria 7249
31 Ga0070717_10014295 3300006028 Bacteria 6105
32 Ga0075365_10124572 3300006038 Bacteria 1780
33 Ga0075366_10143324 3300006195 Bacteria 1445
34 Ga0075366_10656392 3300006195 Bacteria 651
35 Ga0097621_101336028 3300006237 Bacteria 678
36 Ga0075370_10057508 3300006353 Bacteria 2210
37 Ga0075370_10158284 3300006353 Bacteria 1328
38 Ga0105240_10714507 3300009093 Bacteria 1093
39 Ga0111539_10783213 3300009094 Bacteria 1110
40 Ga0105248_11701686 3300009177 Bacteria 715
41 Ga0105237_10036649 3300009545 Bacteria 4963
42 Ga0157371_10188709 3300013102 Bacteria 1475
43 Ga0157370_10402254 3300013104 Unclassified 1260
44 Ga0157378_10484701 3300013297 Bacteria 1233
45 Ga0163163_10000557 3300014325 Bacteria 32741
46 Ga0157380_10026466 3300014326 Bacteria 4404
47 Ga0182008_10027811 3300014497 Bacteria 2862
48 Ga0182008_10323837 3300014497 Bacteria 812
49 Ga0182008_10531569 3300014497 Bacteria 651
50 Ga0209258_100072 3300025242 Bacteria 274355
51 Ga0207425_1001619 3300025245 Bacteria 9083
52 Ga0209148_1028298 3300025254 Bacteria 854
53 Ga0209759_1001038 3300025256 Bacteria 18597
54 Ga0209129_1000012 3300025258 Bacteria 541516
55 Ga0209455_1000053 3300025272 Bacteria 365949
56 Ga0209673_1007121 3300025273 Bacteria 5236
57 Ga0209673_1013690 3300025273 Bacteria 3188
58 Ga0209676_1017218 3300025292 Bacteria 2569
59 Ga0209564_1000022 3300025295 Bacteria 555109
60 Ga0209758_1000659 3300025297 Bacteria 51717
61 Ga0209050_1000165 3300025298 Bacteria 152109
62 Ga0209256_1046335 3300025299 Bacteria 1075
63 Ga0209051_1000159 3300025303 Bacteria 126836
64 Ga0209051_1049632 3300025303 Bacteria 1412
65 Ga0207642_10282722 3300025899 Bacteria 955
66 Ga0207699_10031584 3300025906 Bacteria 2975
67 Ga0207705_10136487 3300025909 Bacteria 1829
68 Ga0207705_10158443 3300025909 Bacteria 1699
69 Ga0207705_10202313 3300025909 Unclassified 1505
70 Ga0207663_10029401 3300025916 Bacteria 3227
71 Ga0207657_10840700 3300025919 Bacteria 709
72 Ga0207694_10082468 3300025924 Bacteria 2528
73 Ga0207650_10003727 3300025925 Bacteria 10424
74 Ga0207700_10003071 3300025928 Bacteria 9643
75 Ga0207700_10338613 3300025928 Bacteria 1307
76 Ga0207664_10003703 3300025929 Bacteria 10249
77 Ga0207669_10775008 3300025937 Bacteria 794
78 Ga0207665_10460488 3300025939 Bacteria 977
79 Ga0207661_10649152 3300025944 Bacteria 970
80 Ga0207679_10027658 3300025945 Bacteria 3925
81 Ga0207712_10837006 3300025961 Bacteria 810
82 Ga0207675_100002445 3300026118 Bacteria 18394
83 Ga0207683_10261049 3300026121 Bacteria 1582
84 Ga0207698_10008912 3300026142 Bacteria 6361
85 Ga0207698_10720614 3300026142 Bacteria 994
86 Ga0307517_10127838 3300028786 Bacteria 1845
87 Ga0316176_1157635 3300030732 Bacteria 719
88 Ga0265316_10087615 3300031344 Bacteria 2378
89 Ga0307408_100110361 3300031548 Bacteria 2112
90 Ga0307514_10004934 3300031649 Bacteria 12118
91 Ga0307405_10532953 3300031731 Bacteria 947
92 Ga0307405_10973530 3300031731 Bacteria 722
93 Ga0307405_11036713 3300031731 Bacteria 702
94 Ga0307413_10294033 3300031824 Bacteria 1228
95 Ga0307413_10700633 3300031824 Bacteria 841
96 Ga0307406_10011859 3300031901 Bacteria 4953
97 Ga0307407_10056401 3300031903 Bacteria 2274
98 Ga0307412_10103829 3300031911 Bacteria 2015
99 Ga0307412_10544712 3300031911 Bacteria 974
100 Ga0307409_100014814 3300031995 Bacteria 5088
101 Ga0307409_100494681 3300031995 Bacteria 1189
102 Ga0307409_100613663 3300031995 Bacteria 1077
103 Ga0307409_100688318 3300031995 Bacteria 1020
104 Ga0307409_101148454 3300031995 Bacteria 799
105 Ga0307416_100045222 3300032002 Bacteria 3465
106 Ga0307416_100141037 3300032002 Bacteria 2190
107 Ga0307416_100435685 3300032002 Bacteria 1359
108 Ga0307416_101042306 3300032002 Bacteria 922
109 Ga0307414_10032077 3300032004 Bacteria 3455
110 Ga0307414_10156718 3300032004 Bacteria 1804
111 Ga0307411_10029624 3300032005 Bacteria 3346
112 Ga0307411_11128591 3300032005 Bacteria 708
113 Ga0307415_100048651 3300032126 Bacteria 2862
114 Ga0307415_100159042 3300032126 Bacteria 1749
115 Ga0307415_100176768 3300032126 Bacteria 1671
116 Ga0307415_101031000 3300032126 Bacteria 766
117 Ga0316593_10046064 3300032168 Bacteria 1463
118 Ga0373947_0070733 3300035725 Unclassified 2139
119 Ga0373947_0278692 3300035725 Bacteria 1111
120 Ga0373937_0415303 3300036401 Bacteria 1277
121 Ga0395900_0206765 3300037418 Bacteria 1984
122 Ga0451855_0510058 3300041511 Bacteria 844
123 Ga0451853_1982668 3300041512 Bacteria 2186
124 Ga0451577_0031154 3300042876 Bacteria 4814
125 Ga0495580_0075406 3300046472 Bacteria 2353
126 Ga0495628_0179745 3300046516 Bacteria 1601
127 Ga0495630_0383655 3300046517 Unclassified 1076
128 Ga0495667_0109052 3300046559 Bacteria 1789
129 Ga0495674_0491587 3300047319 Unclassified 982
130 Ga0495674_0561023 3300047319 Bacteria 908
131 Ga0495684_0592544 3300047471 Unclassified 749
132 Ga0496112_0349230 3300048915 Bacteria 1422
133 Ga0501298_044591 3300049521 Bacteria 906
134 Ga0501216_054548 3300049660 Bacteria 793
135 Ga0501243_015594 3300049675 Bacteria 1223
136 Ga0501234_020450 3300049707 Bacteria 1053
137 Ga0501271_003119 3300049768 Bacteria 1518
138 Ga0501273_058181 3300049770 Bacteria 604
139 Ga0501212_007523 3300049851 Bacteria 1495
140 nmdc:mga0k408_131582_c1 3300050493 Bacteria 1485
141 nmdc:mga07m45_124392_c1 3300050496 Bacteria 1491
142 nmdc:mga0rr50_448822_c1 3300050513 Bacteria 1093
143 Ga0500578_0000007 3300053086 Bacteria 229642
144 Ga0500644_0105772 3300053088 Bacteria 1076
145 Ga0500604_0076055 3300053151 Bacteria 1078
146 Ga0590071_042575 3300059421 Bacteria 1094
147 Ga0590074_019448 3300059423 Bacteria 1165
148 Ga0590075_001149 3300059424 Bacteria 6723
149 2904450564 2904449895 Bacteria 6927402
150 2904456612 2904456579 Bacteria 6819253
151 2914759909 2914759650 Bacteria 4701441
152 2929521279 2929520902 Bacteria 6765052
153 2945949298 2945945610 Bacteria 5951079
154 2945973347 2945972063 Bacteria 6086495
155 Ga0436364_0326358
156 JGI25152J39213_1005497
157 JGI25406J46586_10004645
158 JGI25153J46596_10000405
159 Ga0055535_1000047
160 Ga0055529_1000148
161 Ga0055526_1004403
162 Ga0055530_10005848
163 Ga0055540_1011028
164 Ga0065165_1005989
165 Ga0070658_10099455
166 Ga0070658_10107958
167 Ga0070658_10177398
168 Ga0070683_100808405
169 Ga0070670_100076409
170 Ga0070680_100852624
171 Ga0070660_100995750
172 Ga0070661_100676938
173 Ga0070713_100008578
174 Ga0070711_100104903
175 Ga0070700_100016953
176 Ga0070694_100176534
177 Ga0070665_100767048
178 Ga0070704_100310574
179 Ga0070664_100065301
180 Ga0068861_100000529
181 Ga0081538_10004614
182 Ga0081538_10018570
183 Ga0081538_10038037
184 Ga0081539_10010991
185 Ga0070717_10014295
186 Ga0075365_10124572
187 Ga0075366_10143324
188 Ga0075366_10656392
189 Ga0097621_101336028
190 Ga0075370_10057508
191 Ga0075370_10158284
192 Ga0105240_10714507
193 Ga0111539_10783213
194 Ga0105248_11701686
195 Ga0105237_10036649
196 Ga0157371_10188709
197 Ga0157370_10402254
198 Ga0157378_10484701
199 Ga0163163_10000557
200 Ga0157380_10026466
201 Ga0182008_10027811
202 Ga0182008_10323837
203 Ga0182008_10531569
204 Ga0209258_100072
205 Ga0207425_1001619
206 Ga0209148_1028298
207 Ga0209759_1001038
208 Ga0209129_1000012
209 Ga0209455_1000053
210 Ga0209673_1007121
211 Ga0209673_1013690
212 Ga0209676_1017218
213 Ga0209564_1000022
214 Ga0209758_1000659
215 Ga0209050_1000165
216 Ga0209256_1046335
217 Ga0209051_1000159
218 Ga0209051_1049632
219 Ga0207642_10282722
220 Ga0207699_10031584
221 Ga0207705_10136487
222 Ga0207705_10158443
223 Ga0207705_10202313
224 Ga0207663_10029401
225 Ga0207657_10840700
226 Ga0207694_10082468
227 Ga0207650_10003727
228 Ga0207700_10003071
229 Ga0207700_10338613
230 Ga0207664_10003703
231 Ga0207669_10775008
232 Ga0207665_10460488
233 Ga0207661_10649152
234 Ga0207679_10027658
235 Ga0207712_10837006
236 Ga0207675_100002445
237 Ga0207683_10261049
238 Ga0207698_10008912
239 Ga0207698_10720614
240 Ga0307517_10127838
241 Ga0316176_1157635
242 Ga0265316_10087615
243 Ga0307408_100110361
244 Ga0307514_10004934
245 Ga0307405_10532953
246 Ga0307405_10973530
247 Ga0307405_11036713
248 Ga0307413_10294033
249 Ga0307413_10700633
250 Ga0307406_10011859
251 Ga0307407_10056401
252 Ga0307412_10103829
253 Ga0307412_10544712
254 Ga0307409_100014814
255 Ga0307409_100494681
256 Ga0307409_100613663
257 Ga0307409_100688318
258 Ga0307409_101148454
259 Ga0307416_100045222
260 Ga0307416_100141037
261 Ga0307416_100435685
262 Ga0307416_101042306
263 Ga0307414_10032077
264 Ga0307414_10156718
265 Ga0307411_10029624
266 Ga0307411_11128591
267 Ga0307415_100048651
268 Ga0307415_100159042
269 Ga0307415_100176768
270 Ga0307415_101031000
271 Ga0316593_10046064
272 Ga0373947_0070733
273 Ga0373947_0278692
274 Ga0373937_0415303
275 Ga0395900_0206765
276 Ga0451855_0510058
277 Ga0451853_1982668
278 Ga0451577_0031154
279 Ga0495580_0075406
280 Ga0495628_0179745
281 Ga0495630_0383655
282 Ga0495667_0109052
283 Ga0495674_0491587
284 Ga0495674_0561023
285 Ga0495684_0592544
286 Ga0496112_0349230
287 Ga0501298_044591
288 Ga0501216_054548
289 Ga0501243_015594
290 Ga0501234_020450
291 Ga0501271_003119
292 Ga0501273_058181
293 Ga0501212_007523
294 nmdc:mga0k408_131582_c1
295 nmdc:mga07m45_124392_c1
296 nmdc:mga0rr50_448822_c1
297 Ga0500578_0000007
298 Ga0500644_0105772
299 Ga0500604_0076055
300 Ga0590071_042575
301 Ga0590074_019448
302 Ga0590075_001149
303 2904450564
304 2904456612
305 2914759909
306 2929521279
307 2945949298
308 2945973347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01661

Macro

Macro domain

30

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cb3-assembly1.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9829 5 167
5cb5-assembly10.cif.gz_I structural insights into the mechanism of escherichia coli ymdb 0.979 5 167
4iqy-assembly1.cif.gz_A crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2 0.9755 5 167
6y4y-assembly1.cif.gz_A the crystal structure of human macrod2 in space group p41212 0.9721 5 167
6y73-assembly5.cif.gz_E the crystal structure of human macrod2 in space group p43 0.9719 5 167
ID Description Score Start End Superfamily
5cb5C00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.979 5 167 3.40.220.10
af_F6PBM1_89_319_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9748 5 167 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9724 5 167 3.40.220.10
af_Q54YH9_643_888_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9669 5 167 3.40.220.10
af_Q4DQ03_1_267_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9585 5 167 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A528F0P6-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.002 10 122 GO:0019213
AF-A0A1G4XXC4-F1-model_v4 O-acetyl-ADP-ribose deacetylase (Regulator of RNase III), contains Macro domain 1.001 2 167 GO:0061463
AF-A0A5F2HVQ7-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.001 10 125 GO:0061463
AF-A0A357Z310-F1-model_v4 RNase III inhibitor 1.001 8 125 GO:0019213
AF-A0A644WLU7-F1-model_v4 O-acetyl-ADP-ribose deacetylase (EC 3.5.1.-) 1.001 8 106 GO:0016787

Map