F220856

General Info

Members Datasets Scaffolds Average Seq Length
154 84 308 313

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0338610|Ga0501082_0338610_106_1182
Length 358
Sequence MMVYTTTLRVSQRAVGVISSLPSCVVCGVQSAIVATHPFPRENMAELSSETRFLHAVEMGLGAWQWGDRVVWQYGHGYGDMEVRQAFQVALEEGIRFVDTAEIYGNGRSERLLGQFLKGTDQPVLIATKFLPFPWRFGKGALPRALKGSLSRLGVDSVDLYQIHWPTPLMSIETMMEGLAQCVHSGMTRTAGVSNFGQTSLLAAYSALARHNIPLASNQVHYSLLNRTVEKNGLLARCKELGIRLIAYSPIEKGLLTGKYTAASPPPGSRARIYASLLPKIGPLLKLMTEIGQDYGGKSNAQVALNWVICKGALAIPGAKNAQQAQENAGALGWKLTEEEVSRLDQASDAILESQKAQ

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
67 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
68 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
69 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
70 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
71 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
72 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
73 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
74 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
75 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
76 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
77 2831426010 Nostoc sp. 106C Isolate Unclassified
78 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
79 2849660919 Nostoc sp. T09 Isolate Unclassified
80 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
81 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
82 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
83 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
84 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.42
Metatranscriptomes 3.9
Isolates 11.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 12.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0338610 3300060353 Bacteria 1311
2 JGI25406J46586_10003219 3300003203 Bacteria 7680
3 Ga0006556J51387_1025598 3300003479 Eukaryota 1294
4 Ga0006557J51388_1022993 3300003556 Eukaryota 1328
5 Ga0006559J51393_1027732 3300003560 Eukaryota 1318
6 Ga0006553J51392_1024920 3300003561 Eukaryota 1265
7 Ga0006555J51386_1023254 3300003564 Eukaryota 1296
8 Ga0006554J51385_1022603 3300003567 Eukaryota 1312
9 Ga0065707_10000721 3300005295 Bacteria 12558
10 Ga0065707_10088286 3300005295 Bacteria 4707
11 Ga0065707_10133380 3300005295 Bacteria 1882
12 Ga0070682_100154339 3300005337 Bacteria 1579
13 Ga0070705_100029998 3300005440 Bacteria 2999
14 Ga0070706_100074710 3300005467 Bacteria 3137
15 Ga0070707_100041355 3300005468 Bacteria 4411
16 Ga0070707_100111595 3300005468 Bacteria 2652
17 Ga0070698_100020514 3300005471 Bacteria 6928
18 Ga0070698_100136450 3300005471 Bacteria 2407
19 Ga0070699_100001639 3300005518 Bacteria 20416
20 Ga0070699_100040045 3300005518 Bacteria 4058
21 Ga0070699_100096962 3300005518 Bacteria 2583
22 Ga0070695_100017529 3300005545 Bacteria 4344
23 Ga0081539_10003397 3300005985 Bacteria 19660
24 Ga0075427_10002164 3300006194 Bacteria 2610
25 Ga0075428_100029477 3300006844 Bacteria 6072
26 Ga0075428_100151410 3300006844 Unclassified 2520
27 Ga0075430_100103109 3300006846 Bacteria 2382
28 Ga0075431_100042142 3300006847 Bacteria 4707
29 Ga0075431_100154127 3300006847 Bacteria 2365
30 Ga0075431_100187140 3300006847 Bacteria 2123
31 Ga0075433_10025658 3300006852 Bacteria 4983
32 Ga0075434_100055121 3300006871 Bacteria 3950
33 Ga0075429_100019167 3300006880 Bacteria 5927
34 Ga0075429_100031912 3300006880 Bacteria 4579
35 Ga0075429_100041363 3300006880 Bacteria 4014
36 Ga0075429_100134887 3300006880 Unclassified 2160
37 Ga0111539_10148941 3300009094 Bacteria 2740
38 Ga0114129_10010871 3300009147 Bacteria 12968
39 Ga0114129_10026430 3300009147 Bacteria 8219
40 Ga0114129_10041033 3300009147 Bacteria 6522
41 Ga0114129_10082152 3300009147 Bacteria 4478
42 Ga0105243_10025344 3300009148 Bacteria 4531
43 Ga0105243_10231999 3300009148 Bacteria 1638
44 Ga0105242_10107297 3300009176 Bacteria 2375
45 Ga0105249_10264819 3300009553 Bacteria 1709
46 Ga0105246_10044195 3300011119 Bacteria 3026
47 Ga0207684_10109304 3300025910 Bacteria 2366
48 Ga0207646_10059730 3300025922 Bacteria 3405
49 Ga0207646_10123541 3300025922 Bacteria 2327
50 Ga0207686_10370946 3300025934 Unclassified 1083
51 Ga0207712_10137737 3300025961 Unclassified 1869
52 Ga0207712_10175208 3300025961 Bacteria 1680
53 Ga0207674_10297696 3300026116 Unclassified 1562
54 Ga0207675_100274212 3300026118 Bacteria 1638
55 Ga0265337_1008978 3300028556 Bacteria 3597
56 Ga0265326_10004581 3300028558 Bacteria 4418
57 Ga0265319_1000173 3300028563 Bacteria 49147
58 Ga0265319_1018485 3300028563 Unclassified 2623
59 Ga0265334_10003715 3300028573 Bacteria 6909
60 Ga0265318_10007630 3300028577 Bacteria 4873
61 Ga0265318_10021288 3300028577 Bacteria 2604
62 Ga0265336_10009126 3300028666 Bacteria 3442
63 Ga0265336_10032830 3300028666 Unclassified 1609
64 Ga0265338_10002126 3300028800 Bacteria 30416
65 Ga0265320_10114216 3300031240 Bacteria 1235
66 Ga0265340_10009113 3300031247 Bacteria 5336
67 Ga0265316_10155699 3300031344 Unclassified 1710
68 Ga0316576_10099286 3300031727 Bacteria 2175
69 Ga0316578_10222332 3300031728 Unclassified 1135
70 Ga0307410_10177350 3300031852 Bacteria 1611
71 Ga0307410_10196805 3300031852 Bacteria 1536
72 Ga0307409_100109824 3300031995 Bacteria 2310
73 Ga0307415_100471611 3300032126 Unclassified 1090
74 Ga0373923_0001546 3300035111 Bacteria 6661
75 Ga0373923_0021151 3300035111 Bacteria 2536
76 Ga0373931_0006545 3300035691 Bacteria 5447
77 Ga0373931_0075056 3300035691 Unclassified 1853
78 Ga0373937_0066934 3300036401 Bacteria 3309
79 Ga0373937_0178386 3300036401 Bacteria 1994
80 Ga0316582_0003502 3300036647 Bacteria 7706
81 Ga0316582_0060636 3300036647 Bacteria 2426
82 Ga0316584_0009836 3300036712 Bacteria 6657
83 Ga0316584_0119948 3300036712 Bacteria 1966
84 Ga0436364_0843158 3300037853 Bacteria 4877
85 Ga0436363_0163519 3300039450 Bacteria 1590
86 Ga0451577_0183118 3300042876 Bacteria 1889
87 Ga0451577_0487650 3300042876 Bacteria 1119
88 Ga0451577_0522911 3300042876 Unclassified 1077
89 Ga0451577_0527078 3300042876 Unclassified 1073
90 Ga0453683_0004524 3300044673 Bacteria 9845
91 Ga0453683_0024175 3300044673 Bacteria 3869
92 Ga0453683_0025927 3300044673 Bacteria 3722
93 Ga0453683_0246581 3300044673 Bacteria 1138
94 Ga0453684_0000007 3300044712 Bacteria 1301482
95 Ga0453684_0000484 3300044712 Bacteria 157641
96 Ga0453684_0002604 3300044712 Bacteria 43124
97 Ga0453684_0003918 3300044712 Bacteria 32700
98 Ga0453684_0006243 3300044712 Bacteria 22834
99 Ga0453684_0019386 3300044712 Bacteria 10359
100 Ga0453684_0058167 3300044712 Bacteria 4995
101 Ga0453684_0074990 3300044712 Bacteria 4255
102 Ga0453684_0093613 3300044712 Bacteria 3700
103 Ga0453684_0132609 3300044712 Bacteria 2987
104 Ga0453684_0132911 3300044712 Bacteria 2984
105 Ga0453684_0167383 3300044712 Bacteria 2594
106 Ga0453684_0171061 3300044712 Bacteria 2560
107 Ga0453684_0234764 3300044712 Bacteria 2115
108 Ga0453684_0256933 3300044712 Unclassified 2003
109 Ga0453684_0556684 3300044712 Bacteria 1262
110 Ga0453684_0570400 3300044712 Unclassified 1244
111 Ga0451576_0000273 3300045051 Bacteria 126460
112 Ga0451576_0006383 3300045051 Bacteria 14479
113 Ga0451576_0015407 3300045051 Bacteria 8468
114 Ga0451576_0240665 3300045051 Unclassified 1890
115 Ga0451576_0595213 3300045051 Unclassified 1162
116 Ga0495630_0131979 3300046517 Bacteria 1897
117 Ga0501040_0200266 3300049576 Bacteria 1418
118 Ga0501046_0065402 3300049580 Bacteria 2837
119 Ga0501075_0046897 3300049591 Bacteria 3247
120 Ga0501076_0011548 3300049592 Bacteria 6585
121 Ga0501076_0193400 3300049592 Bacteria 1661
122 Ga0501077_0240991 3300049593 Bacteria 1150
123 nmdc:mga05p37_42894_c1 3300050507 Bacteria 5561
124 nmdc:mga05p37_49945_c1 3300050507 Bacteria 5145
125 nmdc:mga09592_175665_c1 3300050508 Unclassified 1853
126 nmdc:mga09592_33867_c1 3300050508 Bacteria 4268
127 nmdc:mga09592_5174_c1 3300050508 Bacteria 10600
128 nmdc:mga0qj67_207845_c1 3300050509 Bacteria 1590
129 nmdc:mga06r32_173370_c1 3300050510 Bacteria 2141
130 nmdc:mga06r32_83428_c1 3300050510 Bacteria 3114
131 nmdc:mga0n895_567752_c1 3300050512 Bacteria 1139
132 nmdc:mga0n895_92978_c1 3300050512 Bacteria 3019
133 nmdc:mga0a205_288647_c1 3300050515 Bacteria 1515
134 nmdc:mga0a205_294601_c1 3300050515 Bacteria 1496
135 Ga0501084_0137492 3300054114 Unclassified 2057
136 Ga0501082_0377829 3300060353 Bacteria 1236
137 2617913986 2617270889 Bacteria 9064343
138 2617914424 2617270889 Bacteria 9064343
139 2831428357 2831426010 Bacteria 8662725
140 2831431038 2831426010 Bacteria 8662725
141 2848698532 2848694841 Bacteria 9205737
142 2848701384 2848694841 Bacteria 9205737
143 2849664765 2849660919 Bacteria 8251853
144 2849667659 2849660919 Bacteria 8251853
145 2886628756 2886627955 Bacteria 7618130
146 2886632494 2886627955 Bacteria 7618130
147 2913849850 2913844669 Bacteria 8381711
148 2913852057 2913844669 Bacteria 8381711
149 2913912528 2913912277 Bacteria 9037797
150 2913914196 2913912277 Bacteria 9037797
151 2913941107 2913939268 Bacteria 8559644
152 2913942821 2913939268 Bacteria 8559644
153 642600077 642555144 Bacteria 9059191
154 642603484 642555144 Bacteria 9059191
155 Ga0501082_0338610
156 JGI25406J46586_10003219
157 Ga0006556J51387_1025598
158 Ga0006557J51388_1022993
159 Ga0006559J51393_1027732
160 Ga0006553J51392_1024920
161 Ga0006555J51386_1023254
162 Ga0006554J51385_1022603
163 Ga0065707_10000721
164 Ga0065707_10088286
165 Ga0065707_10133380
166 Ga0070682_100154339
167 Ga0070705_100029998
168 Ga0070706_100074710
169 Ga0070707_100041355
170 Ga0070707_100111595
171 Ga0070698_100020514
172 Ga0070698_100136450
173 Ga0070699_100001639
174 Ga0070699_100040045
175 Ga0070699_100096962
176 Ga0070695_100017529
177 Ga0081539_10003397
178 Ga0075427_10002164
179 Ga0075428_100029477
180 Ga0075428_100151410
181 Ga0075430_100103109
182 Ga0075431_100042142
183 Ga0075431_100154127
184 Ga0075431_100187140
185 Ga0075433_10025658
186 Ga0075434_100055121
187 Ga0075429_100019167
188 Ga0075429_100031912
189 Ga0075429_100041363
190 Ga0075429_100134887
191 Ga0111539_10148941
192 Ga0114129_10010871
193 Ga0114129_10026430
194 Ga0114129_10041033
195 Ga0114129_10082152
196 Ga0105243_10025344
197 Ga0105243_10231999
198 Ga0105242_10107297
199 Ga0105249_10264819
200 Ga0105246_10044195
201 Ga0207684_10109304
202 Ga0207646_10059730
203 Ga0207646_10123541
204 Ga0207686_10370946
205 Ga0207712_10137737
206 Ga0207712_10175208
207 Ga0207674_10297696
208 Ga0207675_100274212
209 Ga0265337_1008978
210 Ga0265326_10004581
211 Ga0265319_1000173
212 Ga0265319_1018485
213 Ga0265334_10003715
214 Ga0265318_10007630
215 Ga0265318_10021288
216 Ga0265336_10009126
217 Ga0265336_10032830
218 Ga0265338_10002126
219 Ga0265320_10114216
220 Ga0265340_10009113
221 Ga0265316_10155699
222 Ga0316576_10099286
223 Ga0316578_10222332
224 Ga0307410_10177350
225 Ga0307410_10196805
226 Ga0307409_100109824
227 Ga0307415_100471611
228 Ga0373923_0001546
229 Ga0373923_0021151
230 Ga0373931_0006545
231 Ga0373931_0075056
232 Ga0373937_0066934
233 Ga0373937_0178386
234 Ga0316582_0003502
235 Ga0316582_0060636
236 Ga0316584_0009836
237 Ga0316584_0119948
238 Ga0436364_0843158
239 Ga0436363_0163519
240 Ga0451577_0183118
241 Ga0451577_0487650
242 Ga0451577_0522911
243 Ga0451577_0527078
244 Ga0453683_0004524
245 Ga0453683_0024175
246 Ga0453683_0025927
247 Ga0453683_0246581
248 Ga0453684_0000007
249 Ga0453684_0000484
250 Ga0453684_0002604
251 Ga0453684_0003918
252 Ga0453684_0006243
253 Ga0453684_0019386
254 Ga0453684_0058167
255 Ga0453684_0074990
256 Ga0453684_0093613
257 Ga0453684_0132609
258 Ga0453684_0132911
259 Ga0453684_0167383
260 Ga0453684_0171061
261 Ga0453684_0234764
262 Ga0453684_0256933
263 Ga0453684_0556684
264 Ga0453684_0570400
265 Ga0451576_0000273
266 Ga0451576_0006383
267 Ga0451576_0015407
268 Ga0451576_0240665
269 Ga0451576_0595213
270 Ga0495630_0131979
271 Ga0501040_0200266
272 Ga0501046_0065402
273 Ga0501075_0046897
274 Ga0501076_0011548
275 Ga0501076_0193400
276 Ga0501077_0240991
277 nmdc:mga05p37_42894_c1
278 nmdc:mga05p37_49945_c1
279 nmdc:mga09592_175665_c1
280 nmdc:mga09592_33867_c1
281 nmdc:mga09592_5174_c1
282 nmdc:mga0qj67_207845_c1
283 nmdc:mga06r32_173370_c1
284 nmdc:mga06r32_83428_c1
285 nmdc:mga0n895_567752_c1
286 nmdc:mga0n895_92978_c1
287 nmdc:mga0a205_288647_c1
288 nmdc:mga0a205_294601_c1
289 Ga0501084_0137492
290 Ga0501082_0377829
291 2617913986
292 2617914424
293 2831428357
294 2831431038
295 2848698532
296 2848701384
297 2849664765
298 2849667659
299 2886628756
300 2886632494
301 2913849850
302 2913852057
303 2913912528
304 2913914196
305 2913941107
306 2913942821
307 642600077
308 642603484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

349

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9129 15 302
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.9019 12 302
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9001 15 301
1vbj-assembly2.cif.gz_B the crystal structure of prostaglandin f synthase from trypanosoma brucei 0.8847 15 302
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.8832 15 302
ID Description Score Start End Superfamily
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9644 15 306 3.20.20.100
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9524 15 308 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9121 15 306 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9075 14 302 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9072 15 306 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A530ZNY9-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9863 104 191 GO:0016491
GO:0051596
AF-A0A447TYR4-F1-model_v4 Ion-channel protein 0.9818 111 217 GO:0016491
GO:0051596
AF-A0A822A602-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9817 112 204 GO:0016491
AF-A0A061SEH7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9804 15 307 GO:0004033
GO:0005737
AF-A0A6H1TZZ0-F1-model_v4 Aldo/keto reductase 0.9788 16 180 GO:0004033
GO:0005737

Map