F221746

General Info

Members Datasets Scaffolds Average Seq Length
155 104 155 137

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100679913|Ga0070695_1006799132
Length 151
Sequence VSFCVYLWLNRIMRRFSQRSHLVTLSEINITPLLDLAFVLLIIFIITTPLLTQSIEMKLPGGGQVEKNKLDKSDIRTVEISNTGYYALDSRRMTLPQIVAQIAGEARRNPKLVVYIRADKDCRYDLVAQIIDGCQKNGITRYSLRTDPTTK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
31 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
32 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
40 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
49 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
50 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
51 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
52 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
53 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
56 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0.65
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10353693 3300003323 Bacteria 1157
2 Ga0070658_10175711 3300005327 Unclassified 1801
3 Ga0070689_100025265 3300005340 Bacteria 4462
4 Ga0070691_10134590 3300005341 Bacteria 1255
5 Ga0070711_100000512 3300005439 Bacteria 20157
6 Ga0070694_100526077 3300005444 Bacteria 944
7 Ga0070686_100455146 3300005544 Bacteria 985
8 Ga0070695_100679913 3300005545 Bacteria 815
9 Ga0068857_101706972 3300005577 Unclassified 616
10 Ga0068856_100000247 3300005614 Bacteria 58943
11 Ga0068856_100432943 3300005614 Bacteria 1335
12 Ga0068856_101236720 3300005614 Bacteria 763
13 Ga0068859_100333974 3300005617 Bacteria 1610
14 Ga0068860_101187130 3300005843 Bacteria 783
15 Ga0097620_100333957 3300006931 Bacteria 1610
16 Ga0105240_10239753 3300009093 Bacteria 2103
17 Ga0105240_10650852 3300009093 Bacteria 1155
18 Ga0105248_13431755 3300009177 Unclassified 503
19 Ga0105238_10001266 3300009551 Bacteria 25411
20 Ga0105238_10032680 3300009551 Bacteria 5295
21 Ga0105238_10150696 3300009551 Unclassified 2301
22 Ga0157378_12183665 3300013297 Unclassified 605
23 Ga0163162_11870091 3300013306 Unclassified 687
24 Ga0163163_10763111 3300014325 Unclassified 1030
25 Ga0157376_10104413 3300014969 Bacteria 2483
26 Ga0207685_10474171 3300025905 Unclassified 654
27 Ga0207705_10431483 3300025909 Bacteria 1021
28 Ga0207695_10626280 3300025913 Bacteria 957
29 Ga0207694_10004972 3300025924 Bacteria 10291
30 Ga0207694_10101799 3300025924 Bacteria 2277
31 Ga0207670_10016314 3300025936 Bacteria 4461
32 Ga0207667_10345314 3300025949 Bacteria 1518
33 Ga0207703_12267130 3300026035 Unclassified 519
34 Ga0207702_10017473 3300026078 Bacteria 5933
35 Ga0207702_10222347 3300026078 Unclassified 1760
36 Ga0207702_10519603 3300026078 Bacteria 1162
37 Ga0207702_10652514 3300026078 Bacteria 1035
38 Ga0268264_10676901 3300028381 Bacteria 1023
39 Ga0265337_1006053 3300028556 Bacteria 4717
40 Ga0265337_1011009 3300028556 Bacteria 3137
41 Ga0265337_1024948 3300028556 Bacteria 1823
42 Ga0265337_1070320 3300028556 Bacteria 962
43 Ga0265337_1131677 3300028556 Bacteria 678
44 Ga0265326_10052496 3300028558 Unclassified 1154
45 Ga0265319_1018553 3300028563 Bacteria 2617
46 Ga0265334_10060404 3300028573 Bacteria 1431
47 Ga0265334_10118100 3300028573 Bacteria 949
48 Ga0265318_10016334 3300028577 Bacteria 3068
49 Ga0265318_10271198 3300028577 Bacteria 619
50 Ga0265336_10025420 3300028666 Bacteria 1866
51 Ga0265336_10040033 3300028666 Bacteria 1435
52 Ga0265336_10040889 3300028666 Unclassified 1418
53 Ga0265338_10000184 3300028800 Bacteria 116834
54 Ga0265338_10001733 3300028800 Bacteria 34498
55 Ga0265338_10002298 3300028800 Bacteria 29060
56 Ga0265338_10006014 3300028800 Bacteria 15591
57 Ga0265338_10010152 3300028800 Bacteria 11103
58 Ga0265338_10020973 3300028800 Bacteria 6835
59 Ga0265338_10033708 3300028800 Bacteria 4963
60 Ga0265338_10045352 3300028800 Bacteria 4044
61 Ga0265338_10063514 3300028800 Bacteria 3219
62 Ga0265338_10957127 3300028800 Bacteria 581
63 Ga0265338_10970637 3300028800 Unclassified 576
64 Ga0265324_10000146 3300029957 Bacteria 54469
65 Ga0265324_10020340 3300029957 Bacteria 2385
66 Ga0265760_10207463 3300031090 Unclassified 664
67 Ga0265330_10216869 3300031235 Bacteria 808
68 Ga0265332_10238332 3300031238 Bacteria 753
69 Ga0265320_10030280 3300031240 Unclassified 2792
70 Ga0265320_10419194 3300031240 Bacteria 591
71 Ga0265325_10008563 3300031241 Bacteria 6030
72 Ga0265340_10000859 3300031247 Bacteria 17275
73 Ga0265340_10012055 3300031247 Bacteria 4572
74 Ga0265339_10426185 3300031249 Bacteria 618
75 Ga0265327_10001384 3300031251 Bacteria 30970
76 Ga0265327_10002145 3300031251 Bacteria 21782
77 Ga0265327_10012814 3300031251 Bacteria 5623
78 Ga0265327_10027603 3300031251 Bacteria 3263
79 Ga0265316_10008162 3300031344 Bacteria 9742
80 Ga0265316_10035272 3300031344 Bacteria 4055
81 Ga0265316_10208863 3300031344 Bacteria 1445
82 Ga0265314_10020550 3300031711 Bacteria 5096
83 Ga0265314_10069505 3300031711 Bacteria 2363
84 Ga0373930_0001432 3300034816 Unclassified 3542
85 Ga0373948_0113634 3300034817 Bacteria 648
86 Ga0373950_0006598 3300034818 Bacteria 1776
87 Ga0373938_0006987 3300034957 Bacteria 1972
88 Ga0373928_0001205 3300035084 Bacteria 5115
89 Ga0373929_0000470 3300035085 Bacteria 7714
90 Ga0373944_0000860 3300035089 Bacteria 7465
91 Ga0373949_0003003 3300035090 Bacteria 4144
92 Ga0373951_0010281 3300035091 Unclassified 2101
93 Ga0373932_0000001 3300035112 Bacteria 1459067
94 Ga0373945_0007104 3300035116 Bacteria 3625
95 Ga0373954_0010153 3300035118 Unclassified 4150
96 Ga0373956_0004021 3300035119 Bacteria 5907
97 Ga0373957_0289295 3300035120 Bacteria 694
98 Ga0373946_0197777 3300035171 Unclassified 961
99 Ga0373962_0000045 3300035242 Bacteria 28368
100 Ga0373931_0000002 3300035691 Bacteria 599830
101 Ga0373935_0337418 3300035692 Bacteria 1072
102 Ga0373927_0004454 3300035695 Bacteria 9815
103 Ga0373927_0023242 3300035695 Bacteria 4061
104 Ga0373927_0091985 3300035695 Bacteria 1970
105 Ga0373933_0061388 3300035724 Unclassified 2268
106 Ga0373933_1199504 3300035724 Unclassified 500
107 Ga0373937_0048174 3300036401 Unclassified 3900
108 Ga0373937_0730582 3300036401 Bacteria 937
109 Ga0373937_1489374 3300036401 Unclassified 624
110 Ga0373925_0000977 3300037068 Bacteria 26025
111 Ga0373925_0009377 3300037068 Bacteria 7126
112 Ga0373925_0183456 3300037068 Bacteria 1658
113 Ga0373925_0597035 3300037068 Bacteria 909
114 Ga0453684_1646432 3300044712 Bacteria 657
115 Ga0451576_0034008 3300045051 Bacteria 5416
116 Ga0495629_0033878 3300046459 Unclassified 3612
117 Ga0495580_0674871 3300046472 Bacteria 678
118 Ga0495618_0022495 3300046514 Unclassified 3893
119 Ga0495628_0224997 3300046516 Unclassified 1408
120 Ga0495628_0450526 3300046516 Bacteria 935
121 Ga0495630_0107052 3300046517 Unclassified 2118
122 Ga0495630_0126947 3300046517 Bacteria 1936
123 Ga0495652_0196454 3300046529 Unclassified 1535
124 Ga0495640_0694683 3300046533 Bacteria 610
125 Ga0495586_0005532 3300046535 Bacteria 6756
126 Ga0495586_0149300 3300046535 Bacteria 1314
127 Ga0495587_0751924 3300046536 Unclassified 533
128 Ga0495645_0174334 3300046543 Unclassified 1478
129 Ga0495667_0033855 3300046559 Bacteria 3418
130 Ga0495634_0000900 3300046642 Bacteria 28505
131 Ga0495635_0025860 3300046663 Unclassified 4088
132 Ga0495657_0815069 3300046675 Bacteria 533
133 Ga0495658_0272573 3300046683 Bacteria 1067
134 Ga0495613_0004256 3300046689 Bacteria 10719
135 Ga0495604_0578718 3300047317 Bacteria 722
136 Ga0495676_0908936 3300047321 Unclassified 564
137 Ga0495680_0015110 3300047322 Bacteria 6667
138 Ga0496115_0033452 3300048918 Unclassified 4059
139 Ga0501031_0000239 3300049568 Bacteria 31192
140 Ga0501031_0011910 3300049568 Bacteria 5670
141 Ga0501032_0131776 3300049569 Bacteria 1649
142 Ga0501033_0001502 3300049570 Bacteria 20665
143 Ga0501033_0332843 3300049570 Bacteria 1065
144 Ga0501037_0098426 3300049573 Bacteria 2113
145 Ga0501038_0202195 3300049574 Bacteria 1594
146 Ga0501043_0146509 3300049579 Bacteria 1849
147 Ga0501043_0336496 3300049579 Bacteria 1149
148 Ga0501046_0156485 3300049580 Bacteria 1716
149 Ga0501047_0131526 3300049581 Bacteria 2383
150 Ga0501080_0861832 3300049742 Bacteria 791
151 Ga0501035_0004557 3300049822 Bacteria 13153
152 Ga0501035_0021150 3300049822 Bacteria 5979
153 Ga0501044_0000668 3300049823 Bacteria 41414
154 Ga0500651_0039449 3300053093 Unclassified 2974
155 Ga0500650_0063978 3300053098 Bacteria 1718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025905 Ga0207685_10474171 Ga0207685_104741711 116
2 3300031090 Ga0265760_10207463 Ga0265760_102074632 126
3 3300046516 Ga0495628_0224997 Ga0495628_0224997_987_1373 128
4 3300028800 Ga0265338_10002298 Ga0265338_1000229810 129
5 3300028800 Ga0265338_10045352 Ga0265338_100453523 129
6 3300031251 Ga0265327_10027603 Ga0265327_100276035 129
7 3300036401 Ga0373937_1489374 Ga0373937_1489374_222_611 129
8 3300046543 Ga0495645_0174334 Ga0495645_0174334_984_1373 129
9 3300028563 Ga0265319_1018553 Ga0265319_10185533 136
10 3300028577 Ga0265318_10016334 Ga0265318_100163344 136
11 3300028800 Ga0265338_10006014 Ga0265338_100060141 136
12 3300031238 Ga0265332_10238332 Ga0265332_102383322 136
13 3300031251 Ga0265327_10001384 Ga0265327_1000138414 136
14 3300031711 Ga0265314_10069505 Ga0265314_100695053 136
15 3300035724 Ga0373933_1199504 Ga0373933_1199504_77_487 136
16 3300005444 Ga0070694_100526077 Ga0070694_1005260772 137
17 3300009093 Ga0105240_10239753 Ga0105240_102397531 137
18 3300013297 Ga0157378_12183665 Ga0157378_121836651 137
19 3300014325 Ga0163163_10763111 Ga0163163_107631111 137
20 3300028577 Ga0265318_10271198 Ga0265318_102711981 137
21 3300028800 Ga0265338_10001733 Ga0265338_1000173317 137
22 3300028800 Ga0265338_10010152 Ga0265338_100101527 137
23 3300028800 Ga0265338_10957127 Ga0265338_109571271 137
24 3300031240 Ga0265320_10030280 Ga0265320_100302803 137
25 3300031344 Ga0265316_10008162 Ga0265316_100081623 137
26 3300031344 Ga0265316_10035272 Ga0265316_100352723 137
27 3300035118 Ga0373954_0010153 Ga0373954_0010153_1535_1948 137
28 3300035119 Ga0373956_0004021 Ga0373956_0004021_4407_4820 137
29 3300035120 Ga0373957_0289295 Ga0373957_0289295_233_646 137
30 3300035724 Ga0373933_0061388 Ga0373933_0061388_1291_1704 137
31 3300036401 Ga0373937_0048174 Ga0373937_0048174_2587_3000 137
32 3300045051 Ga0451576_0034008 Ga0451576_0034008_3591_4004 137
33 3300046459 Ga0495629_0033878 Ga0495629_0033878_2424_2837 137
34 3300046472 Ga0495580_0674871 Ga0495580_0674871_89_502 137
35 3300046514 Ga0495618_0022495 Ga0495618_0022495_1945_2358 137
36 3300046517 Ga0495630_0107052 Ga0495630_0107052_1157_1570 137
37 3300046517 Ga0495630_0126947 Ga0495630_0126947_1019_1432 137
38 3300046529 Ga0495652_0196454 Ga0495652_0196454_795_1208 137
39 3300046533 Ga0495640_0694683 Ga0495640_0694683_96_509 137
40 3300046535 Ga0495586_0005532 Ga0495586_0005532_1730_2143 137
41 3300046535 Ga0495586_0149300 Ga0495586_0149300_594_1007 137
42 3300046536 Ga0495587_0751924 Ga0495587_0751924_105_518 137
43 3300046559 Ga0495667_0033855 Ga0495667_0033855_887_1300 137
44 3300046642 Ga0495634_0000900 Ga0495634_0000900_13530_13943 137
45 3300046663 Ga0495635_0025860 Ga0495635_0025860_715_1128 137
46 3300046675 Ga0495657_0815069 Ga0495657_0815069_102_515 137
47 3300046683 Ga0495658_0272573 Ga0495658_0272573_480_893 137
48 3300046689 Ga0495613_0004256 Ga0495613_0004256_5697_6110 137
49 3300047317 Ga0495604_0578718 Ga0495604_0578718_116_529 137
50 3300047321 Ga0495676_0908936 Ga0495676_0908936_31_444 137
51 3300047322 Ga0495680_0015110 Ga0495680_0015110_2317_2730 137
52 3300005327 Ga0070658_10175711 Ga0070658_101757112 138
53 3300005341 Ga0070691_10134590 Ga0070691_101345902 138
54 3300005439 Ga0070711_100000512 Ga0070711_1000005123 138
55 3300005545 Ga0070695_100679913 Ga0070695_1006799132 138
56 3300005577 Ga0068857_101706972 Ga0068857_1017069722 138
57 3300005614 Ga0068856_100000247 Ga0068856_10000024717 138
58 3300005614 Ga0068856_100432943 Ga0068856_1004329433 138
59 3300009093 Ga0105240_10650852 Ga0105240_106508522 138
60 3300009551 Ga0105238_10001266 Ga0105238_100012665 138
61 3300009551 Ga0105238_10032680 Ga0105238_100326805 138
62 3300009551 Ga0105238_10150696 Ga0105238_101506963 138
63 3300014969 Ga0157376_10104413 Ga0157376_101044133 138
64 3300025909 Ga0207705_10431483 Ga0207705_104314832 138
65 3300025913 Ga0207695_10626280 Ga0207695_106262802 138
66 3300025924 Ga0207694_10004972 Ga0207694_1000497211 138
67 3300025924 Ga0207694_10101799 Ga0207694_101017992 138
68 3300025949 Ga0207667_10345314 Ga0207667_103453142 138
69 3300026035 Ga0207703_12267130 Ga0207703_122671301 138
70 3300026078 Ga0207702_10017473 Ga0207702_100174731 138
71 3300026078 Ga0207702_10222347 Ga0207702_102223471 138
72 3300026078 Ga0207702_10519603 Ga0207702_105196032 138
73 3300028556 Ga0265337_1024948 Ga0265337_10249483 138
74 3300028556 Ga0265337_1070320 Ga0265337_10703202 138
75 3300028556 Ga0265337_1131677 Ga0265337_11316772 138
76 3300028558 Ga0265326_10052496 Ga0265326_100524962 138
77 3300028573 Ga0265334_10118100 Ga0265334_101181002 138
78 3300028666 Ga0265336_10025420 Ga0265336_100254203 138
79 3300028666 Ga0265336_10040033 Ga0265336_100400332 138
80 3300028666 Ga0265336_10040889 Ga0265336_100408893 138
81 3300028800 Ga0265338_10033708 Ga0265338_100337085 138
82 3300028800 Ga0265338_10063514 Ga0265338_100635141 138
83 3300028800 Ga0265338_10970637 Ga0265338_109706371 138
84 3300029957 Ga0265324_10000146 Ga0265324_1000014632 138
85 3300029957 Ga0265324_10020340 Ga0265324_100203403 138
86 3300031240 Ga0265320_10419194 Ga0265320_104191941 138
87 3300031241 Ga0265325_10008563 Ga0265325_100085634 138
88 3300031247 Ga0265340_10000859 Ga0265340_100008592 138
89 3300031247 Ga0265340_10012055 Ga0265340_100120555 138
90 3300031249 Ga0265339_10426185 Ga0265339_104261851 138
91 3300031251 Ga0265327_10002145 Ga0265327_1000214513 138
92 3300031251 Ga0265327_10012814 Ga0265327_100128144 138
93 3300031344 Ga0265316_10208863 Ga0265316_102088632 138
94 3300034816 Ga0373930_0001432 Ga0373930_0001432_1080_1496 138
95 3300034817 Ga0373948_0113634 Ga0373948_0113634_88_504 138
96 3300034818 Ga0373950_0006598 Ga0373950_0006598_345_761 138
97 3300034957 Ga0373938_0006987 Ga0373938_0006987_402_818 138
98 3300035084 Ga0373928_0001205 Ga0373928_0001205_3515_3931 138
99 3300035085 Ga0373929_0000470 Ga0373929_0000470_5779_6195 138
100 3300035089 Ga0373944_0000860 Ga0373944_0000860_3494_3910 138
101 3300035090 Ga0373949_0003003 Ga0373949_0003003_2612_3028 138
102 3300035091 Ga0373951_0010281 Ga0373951_0010281_1581_1997 138
103 3300035112 Ga0373932_0000001 Ga0373932_0000001_1085824_1086240 138
104 3300035116 Ga0373945_0007104 Ga0373945_0007104_865_1281 138
105 3300035171 Ga0373946_0197777 Ga0373946_0197777_504_920 138
106 3300035242 Ga0373962_0000045 Ga0373962_0000045_3519_3935 138
107 3300035691 Ga0373931_0000002 Ga0373931_0000002_409158_409574 138
108 3300035692 Ga0373935_0337418 Ga0373935_0337418_182_598 138
109 3300035695 Ga0373927_0023242 Ga0373927_0023242_3484_3900 138
110 3300035695 Ga0373927_0091985 Ga0373927_0091985_450_866 138
111 3300036401 Ga0373937_0730582 Ga0373937_0730582_468_884 138
112 3300037068 Ga0373925_0000977 Ga0373925_0000977_5458_5874 138
113 3300037068 Ga0373925_0183456 Ga0373925_0183456_860_1276 138
114 3300037068 Ga0373925_0597035 Ga0373925_0597035_465_881 138
115 3300046516 Ga0495628_0450526 Ga0495628_0450526_472_891 138
116 3300049568 Ga0501031_0000239 Ga0501031_0000239_1100_1516 138
117 3300049568 Ga0501031_0011910 Ga0501031_0011910_1251_1667 138
118 3300049569 Ga0501032_0131776 Ga0501032_0131776_121_537 138
119 3300049570 Ga0501033_0001502 Ga0501033_0001502_1078_1494 138
120 3300049570 Ga0501033_0332843 Ga0501033_0332843_491_907 138
121 3300049573 Ga0501037_0098426 Ga0501037_0098426_1676_2092 138
122 3300049574 Ga0501038_0202195 Ga0501038_0202195_442_858 138
123 3300049579 Ga0501043_0146509 Ga0501043_0146509_108_524 138
124 3300049579 Ga0501043_0336496 Ga0501043_0336496_85_501 138
125 3300049580 Ga0501046_0156485 Ga0501046_0156485_658_1074 138
126 3300049581 Ga0501047_0131526 Ga0501047_0131526_211_627 138
127 3300049742 Ga0501080_0861832 Ga0501080_0861832_221_637 138
128 3300049822 Ga0501035_0004557 Ga0501035_0004557_740_1156 138
129 3300049822 Ga0501035_0021150 Ga0501035_0021150_865_1281 138
130 3300049823 Ga0501044_0000668 Ga0501044_0000668_39892_40308 138
131 3300053093 Ga0500651_0039449 Ga0500651_0039449_920_1336 138
132 3300053098 Ga0500650_0063978 Ga0500650_0063978_1011_1427 138
133 3300005340 Ga0070689_100025265 Ga0070689_1000252654 139
134 3300005544 Ga0070686_100455146 Ga0070686_1004551462 139
135 3300005614 Ga0068856_101236720 Ga0068856_1012367202 139
136 3300005617 Ga0068859_100333974 Ga0068859_1003339743 139
137 3300005843 Ga0068860_101187130 Ga0068860_1011871302 139
138 3300006931 Ga0097620_100333957 Ga0097620_1003339573 139
139 3300009177 Ga0105248_13431755 Ga0105248_134317551 139
140 3300013306 Ga0163162_11870091 Ga0163162_118700912 139
141 3300025936 Ga0207670_10016314 Ga0207670_100163143 139
142 3300026078 Ga0207702_10652514 Ga0207702_106525142 139
143 3300028381 Ga0268264_10676901 Ga0268264_106769012 139
144 3300028556 Ga0265337_1011009 Ga0265337_10110092 139
145 3300028573 Ga0265334_10060404 Ga0265334_100604042 139
146 3300028800 Ga0265338_10000184 Ga0265338_1000018488 139
147 3300028800 Ga0265338_10020973 Ga0265338_100209735 139
148 3300031235 Ga0265330_10216869 Ga0265330_102168691 139
149 3300031711 Ga0265314_10020550 Ga0265314_100205505 139
150 3300044712 Ga0453684_1646432 Ga0453684_1646432_218_637 139
151 3300048918 Ga0496115_0033452 Ga0496115_0033452_1236_1655 139
152 3300003323 rootH1_10353693 rootH1_103536932 140
153 3300028556 Ga0265337_1006053 Ga0265337_10060532 140
154 3300035695 Ga0373927_0004454 Ga0373927_0004454_4194_4616 140
155 3300037068 Ga0373925_0009377 Ga0373925_0009377_4291_4713 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

23

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8516 63 133
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8209 63 133
1z26-assembly1.cif.gz_A structure of pyrococcus furiosus argonaute with bound tungstate 0.7976 84 135
1z25-assembly1.cif.gz_A structure of p.furiosus argonaute with bound mn2+ 0.7935 84 135
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7574 52 136
ID Description Score Start End Superfamily
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7683 84 135 3.40.50.2300
af_A4HWL8_27_158_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7582 85 135 3.30.420.40
3pnnA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7423 86 134 3.90.550.10
af_Q58366_8_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7267 86 134 3.40.50.620
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7263 88 132 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Z9Q4R5-F1-model_v4 deleted 0.8989 51 135
AF-A0A382XR48-F1-model_v4 Uncharacterized protein 0.8843 53 134
AF-A0A3M5P2T7-F1-model_v4 TonB system transport protein ExbD 0.8561 50 135 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z9Q4R5-F1-model_v4 deleted 0.8528 51 135
AF-A0A349WI13-F1-model_v4 Biopolymer transporter ExbD 0.8448 46 135 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
80.35 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map