F222255

General Info

Members Datasets Scaffolds Average Seq Length
155 120 131 270

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10464192|Ga0157369_104641922
Length 292
Sequence MMEGMNDVSDGMPAGSQGHAEVAAASLGIAVAQFAPGADPEVNLRAMRSLAQTAAARGARLVVFPEYSSYFAEPLGTELLKHAQRLDGAFVTGLAEIACALHVHIVAGVVEQSDDPHRVHNTLVALSPQGELVARYRKQHLYDAFGASESQWMLPGSLDEPETFEVDGVHVGLQTCYDIRFPEVSRRIADAGARLILVPAEWVRGPLKEAHWRTLLAARALENTVYIAAADHVPPTGVGLSVIIDPMGVELAALGETTDAAVAWVSNRRVDEVRRVNPSLALRRYRVLPTGE

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221549 Agromyces sp. Root1464 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
8 2643221649 Leifsonia sp. Root4 Isolate Unclassified
9 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
10 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
11 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
12 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
15 2808606372 Agromyces sp. 23-23 Isolate Unclassified
16 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
17 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
18 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
19 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
20 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
21 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
22 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
118 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
119 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
120 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.52
Metatranscriptomes 0
Isolates 15.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 1.29
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 25.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002250 3300002738 Bacteria 5288
2 Ga0070658_10009497 3300005327 Bacteria 7816
3 Ga0070658_10013220 3300005327 Bacteria 6622
4 Ga0070658_10176512 3300005327 Bacteria 1797
5 Ga0068868_100033017 3300005338 Bacteria 3986
6 Ga0070660_100428798 3300005339 Bacteria 1095
7 Ga0070661_100082976 3300005344 Bacteria 2367
8 Ga0070659_100004973 3300005366 Bacteria 9515
9 Ga0070667_100018975 3300005367 Bacteria 5702
10 Ga0070714_100423937 3300005435 Bacteria 1261
11 Ga0070663_100021980 3300005455 Bacteria 4254
12 Ga0068853_100138375 3300005539 Bacteria 2185
13 Ga0070672_100065846 3300005543 Bacteria 2867
14 Ga0068855_100010325 3300005563 Bacteria 11261
15 Ga0068855_100040173 3300005563 Bacteria 5553
16 Ga0068855_100057868 3300005563 Bacteria 4543
17 Ga0068855_100235266 3300005563 Bacteria 2049
18 Ga0068854_100354073 3300005578 Bacteria 1202
19 Ga0068856_100114943 3300005614 Bacteria 2690
20 Ga0068856_100236948 3300005614 Bacteria 1840
21 Ga0068852_100056656 3300005616 Bacteria 3388
22 Ga0068851_10000009 3300005834 Bacteria 217844
23 Ga0068863_100455564 3300005841 Bacteria 1256
24 Ga0068858_100000095 3300005842 Bacteria 92510
25 Ga0075365_10179944 3300006038 Bacteria 1478
26 Ga0075364_10040712 3300006051 Bacteria 3014
27 Ga0105244_10110648 3300009036 Bacteria 1337
28 Ga0105240_10002334 3300009093 Bacteria 30680
29 Ga0105245_10006229 3300009098 Bacteria 10493
30 Ga0105245_10026497 3300009098 Bacteria 5103
31 Ga0105247_10120116 3300009101 Bacteria 1702
32 Ga0105243_10137904 3300009148 Bacteria 2078
33 Ga0105241_10004446 3300009174 Bacteria 10365
34 Ga0105248_10014591 3300009177 Bacteria 8646
35 Ga0105237_10001060 3300009545 Bacteria 36944
36 Ga0105237_10015106 3300009545 Bacteria 8047
37 Ga0105238_10019314 3300009551 Bacteria 6942
38 Ga0105238_10972589 3300009551 Bacteria 869
39 Ga0157369_10001767 3300013105 Bacteria 26200
40 Ga0157369_10464192 3300013105 Bacteria 1311
41 Ga0171462_1003 3300013250 Bacteria 853796
42 Ga0157374_10909588 3300013296 Bacteria 898
43 Ga0163162_10369431 3300013306 Bacteria 1567
44 Ga0157372_10085594 3300013307 Bacteria 3576
45 Ga0163163_10016117 3300014325 Bacteria 6933
46 Ga0157379_10012299 3300014968 Bacteria 7475
47 Ga0209646_1000092 3300025246 Bacteria 185930
48 Ga0209148_1000532 3300025254 Bacteria 37402
49 Ga0207656_10000001 3300025321 Bacteria 1323684
50 Ga0207656_10000003 3300025321 Bacteria 771644
51 Ga0207656_10000004 3300025321 Bacteria 632320
52 Ga0207705_10000001 3300025909 Bacteria 2061880
53 Ga0207654_10000003 3300025911 Bacteria 1030378
54 Ga0207695_10003467 3300025913 Bacteria 22199
55 Ga0207671_10000001 3300025914 Bacteria 1318881
56 Ga0207671_10020295 3300025914 Bacteria 5061
57 Ga0207657_10107112 3300025919 Bacteria 2312
58 Ga0207694_10000312 3300025924 Bacteria 45743
59 Ga0207694_10385649 3300025924 Bacteria 1163
60 Ga0207687_10007505 3300025927 Bacteria 7170
61 Ga0207690_10011500 3300025932 Bacteria 5291
62 Ga0207691_10085935 3300025940 Bacteria 2823
63 Ga0207711_10000289 3300025941 Bacteria 53688
64 Ga0207667_10015647 3300025949 Bacteria 8605
65 Ga0207667_10018969 3300025949 Bacteria 7692
66 Ga0207667_10046183 3300025949 Bacteria 4612
67 Ga0207667_10174076 3300025949 Bacteria 2212
68 Ga0207640_10199131 3300025981 Bacteria 1516
69 Ga0207677_10024778 3300026023 Bacteria 3733
70 Ga0207639_10026825 3300026041 Bacteria 4189
71 Ga0207639_10056277 3300026041 Bacteria 3014
72 Ga0207678_10011199 3300026067 Bacteria 7876
73 Ga0207702_10054206 3300026078 Bacteria 3397
74 Ga0207641_10112420 3300026088 Bacteria 2417
75 Ga0207641_10236406 3300026088 Bacteria 1700
76 Ga0207676_10306973 3300026095 Bacteria 1451
77 Ga0207674_10003568 3300026116 Bacteria 18973
78 Ga0307406_10024069 3300031901 Bacteria 3632
79 Ga0307416_100330476 3300032002 Bacteria 1532
80 Ga0307416_100648441 3300032002 Bacteria 1140
81 Ga0439461_0007542 3300041410 Bacteria 1930
82 Ga0439466_0005309 3300041411 Bacteria 4928
83 Ga0439431_0000972 3300041997 Bacteria 6218
84 Ga0439434_0024826 3300042435 Bacteria 1808
85 Ga0466968_0081929 3300044735 Bacteria 1419
86 Ga0466970_0159971 3300044765 Bacteria 1245
87 Ga0466957_0260454 3300044842 Bacteria 1156
88 Ga0466960_0026798 3300044901 Bacteria 2622
89 Ga0466959_0109847 3300045049 Bacteria 1969
90 Ga0495627_008396 3300046453 Bacteria 3877
91 Ga0495638_0038719 3300046460 Bacteria 3028
92 Ga0495615_0023466 3300048090 Bacteria 1414
93 Ga0496100_0079074 3300048903 Bacteria 2215
94 Ga0496115_0259754 3300048918 Bacteria 1428
95 Ga0496117_0002228 3300048920 Bacteria 25067
96 Ga0496117_0024749 3300048920 Bacteria 4736
97 Ga0496118_0029124 3300048921 Bacteria 4637
98 Ga0496119_0006727 3300048922 Bacteria 10562
99 Ga0496119_0045324 3300048922 Bacteria 2758
100 Ga0496119_0163591 3300048922 Bacteria 1180
101 Ga0496119_0173420 3300048922 Bacteria 1137
102 Ga0496120_0000503 3300048923 Bacteria 61033
103 Ga0496120_0044302 3300048923 Bacteria 2586
104 Ga0496121_0000289 3300048924 Bacteria 104434
105 Ga0496121_0041298 3300048924 Bacteria 4034
106 Ga0496122_0019171 3300048925 Bacteria 6265
107 Ga0496122_0098478 3300048925 Bacteria 1964
108 Ga0496122_0254172 3300048925 Bacteria 980
109 Ga0496125_0004641 3300048928 Bacteria 15689
110 Ga0496125_0239454 3300048928 Bacteria 1153
111 Ga0496126_0003066 3300048929 Bacteria 21639
112 Ga0496126_0009669 3300048929 Bacteria 10217
113 Ga0496126_0011124 3300048929 Bacteria 9346
114 Ga0496126_0173337 3300048929 Bacteria 1836
115 Ga0496126_0206362 3300048929 Bacteria 1656
116 Ga0496126_0219339 3300048929 Bacteria 1598
117 Ga0501031_0190156 3300049568 Bacteria 1340
118 Ga0501034_0001286 3300049571 Bacteria 33921
119 Ga0501034_0015687 3300049571 Bacteria 7780
120 Ga0501043_0049017 3300049579 Bacteria 3320
121 Ga0501047_0061499 3300049581 Bacteria 3623
122 Ga0501070_0003126 3300049586 Bacteria 14415
123 Ga0501074_0227793 3300049590 Bacteria 1327
124 Ga0501080_0134312 3300049742 Bacteria 2290
125 Ga0501083_0307815 3300049744 Bacteria 1030
126 Ga0501044_0016667 3300049823 Bacteria 7890
127 nmdc:mga00v17_94145_c1 3300050491 Bacteria 1884
128 nmdc:mga0yw44_150468_c1 3300050492 Bacteria 1518
129 Ga0500651_0000764 3300053093 Bacteria 15710
130 Ga0500590_003647 3300053148 Bacteria 7147
131 Ga0500620_000673 3300053155 Bacteria 5845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0098478 Ga0496122_0098478_806_1609 225
2 3300005455 Ga0070663_100021980 Ga0070663_1000219801 226
3 3300013296 Ga0157374_10909588 Ga0157374_109095881 226
4 3300044842 Ga0466957_0260454 Ga0466957_0260454_29_724 226
5 3300025919 Ga0207657_10107112 Ga0207657_101071122 227
6 3300009098 Ga0105245_10026497 Ga0105245_100264976 228
7 3300025927 Ga0207687_10007505 Ga0207687_100075057 228
8 3300032002 Ga0307416_100648441 Ga0307416_1006484411 242
9 3300048924 Ga0496121_0041298 Ga0496121_0041298_2693_3538 247
10 3300048929 Ga0496126_0003066 Ga0496126_0003066_20684_21493 248
11 3300049744 Ga0501083_0307815 Ga0501083_0307815_33_845 248
12 3300048903 Ga0496100_0079074 Ga0496100_0079074_41_847 249
13 3300048918 Ga0496115_0259754 Ga0496115_0259754_388_1194 249
14 3300005435 Ga0070714_100423937 Ga0070714_1004239372 256
15 3300013250 Ga0171462_1003 Ga0171462_100341 257
16 3300049586 Ga0501070_0003126 Ga0501070_0003126_10926_11729 257
17 3300053155 Ga0500620_000673 Ga0500620_000673_4641_5477 258
18 iso_pu_bacteria 2585428094 2587863084 259
19 iso_pu_bacteria 2902810491 2902811006 260
20 iso_pu_bacteria 8056060235 8056061313 260
21 3300009036 Ga0105244_10110648 Ga0105244_101106482 261
22 3300048920 Ga0496117_0024749 Ga0496117_0024749_1001_1834 263
23 3300048923 Ga0496120_0000503 Ga0496120_0000503_8897_9730 263
24 iso_pu_bacteria 2773857763 2774399082 263
25 iso_pu_bacteria 8045830549 8045831940 263
26 3300041410 Ga0439461_0007542 Ga0439461_0007542_572_1369 264
27 3300041411 Ga0439466_0005309 Ga0439466_0005309_2564_3361 264
28 3300041997 Ga0439431_0000972 Ga0439431_0000972_2211_3008 264
29 3300042435 Ga0439434_0024826 Ga0439434_0024826_829_1626 264
30 3300044765 Ga0466970_0159971 Ga0466970_0159971_420_1229 264
31 3300045049 Ga0466959_0109847 Ga0466959_0109847_394_1203 264
32 iso_pu_bacteria 2643221542 2643732018 265
33 iso_pu_bacteria 2643221630 2644170833 265
34 iso_pu_bacteria 2852663356 2852664633 265
35 iso_pu_bacteria 2857723135 2857723254 265
36 iso_pu_bacteria 2939660829 2939662299 265
37 iso_pu_bacteria 2946041624 2946043572 265
38 iso_pu_bacteria 2946080515 2946081506 265
39 3300013307 Ga0157372_10085594 Ga0157372_100855943 266
40 3300044901 Ga0466960_0026798 Ga0466960_0026798_1558_2373 266
41 iso_pu_bacteria 2643221549 2643769606 266
42 3300048922 Ga0496119_0006727 Ga0496119_0006727_6832_7635 267
43 3300049571 Ga0501034_0001286 Ga0501034_0001286_12252_13058 267
44 3300049590 Ga0501074_0227793 Ga0501074_0227793_171_983 267
45 3300049742 Ga0501080_0134312 Ga0501080_0134312_41_853 267
46 3300005327 Ga0070658_10176512 Ga0070658_101765122 268
47 3300005563 Ga0068855_100235266 Ga0068855_1002352663 268
48 3300009551 Ga0105238_10972589 Ga0105238_109725891 268
49 3300013105 Ga0157369_10001767 Ga0157369_1000176721 268
50 3300044735 Ga0466968_0081929 Ga0466968_0081929_574_1380 268
51 3300002738 JGI25154J39366_1002250 JGI25154J39366_10022505 269
52 3300005327 Ga0070658_10009497 Ga0070658_100094974 269
53 3300005327 Ga0070658_10013220 Ga0070658_100132205 269
54 3300005338 Ga0068868_100033017 Ga0068868_1000330174 269
55 3300005339 Ga0070660_100428798 Ga0070660_1004287981 269
56 3300005344 Ga0070661_100082976 Ga0070661_1000829763 269
57 3300005366 Ga0070659_100004973 Ga0070659_1000049737 269
58 3300005367 Ga0070667_100018975 Ga0070667_1000189755 269
59 3300005539 Ga0068853_100138375 Ga0068853_1001383752 269
60 3300005543 Ga0070672_100065846 Ga0070672_1000658462 269
61 3300005563 Ga0068855_100010325 Ga0068855_1000103256 269
62 3300005563 Ga0068855_100040173 Ga0068855_1000401735 269
63 3300005563 Ga0068855_100057868 Ga0068855_1000578684 269
64 3300005578 Ga0068854_100354073 Ga0068854_1003540732 269
65 3300005614 Ga0068856_100114943 Ga0068856_1001149433 269
66 3300005614 Ga0068856_100236948 Ga0068856_1002369482 269
67 3300005616 Ga0068852_100056656 Ga0068852_1000566562 269
68 3300005834 Ga0068851_10000009 Ga0068851_10000009145 269
69 3300005841 Ga0068863_100455564 Ga0068863_1004555642 269
70 3300005842 Ga0068858_100000095 Ga0068858_10000009570 269
71 3300006038 Ga0075365_10179944 Ga0075365_101799442 269
72 3300006051 Ga0075364_10040712 Ga0075364_100407123 269
73 3300009093 Ga0105240_10002334 Ga0105240_1000233421 269
74 3300009098 Ga0105245_10006229 Ga0105245_100062296 269
75 3300009101 Ga0105247_10120116 Ga0105247_101201162 269
76 3300009148 Ga0105243_10137904 Ga0105243_101379042 269
77 3300009174 Ga0105241_10004446 Ga0105241_100044469 269
78 3300009177 Ga0105248_10014591 Ga0105248_100145912 269
79 3300009545 Ga0105237_10001060 Ga0105237_1000106023 269
80 3300009545 Ga0105237_10015106 Ga0105237_100151067 269
81 3300009551 Ga0105238_10019314 Ga0105238_100193145 269
82 3300013105 Ga0157369_10464192 Ga0157369_104641922 269
83 3300013306 Ga0163162_10369431 Ga0163162_103694312 269
84 3300014325 Ga0163163_10016117 Ga0163163_100161173 269
85 3300014968 Ga0157379_10012299 Ga0157379_100122997 269
86 3300025246 Ga0209646_1000092 Ga0209646_100009216 269
87 3300025254 Ga0209148_1000532 Ga0209148_10005324 269
88 3300025321 Ga0207656_10000001 Ga0207656_10000001385 269
89 3300025321 Ga0207656_10000003 Ga0207656_10000003491 269
90 3300025321 Ga0207656_10000004 Ga0207656_10000004347 269
91 3300025909 Ga0207705_10000001 Ga0207705_1000000156 269
92 3300025911 Ga0207654_10000003 Ga0207654_10000003692 269
93 3300025913 Ga0207695_10003467 Ga0207695_1000346711 269
94 3300025914 Ga0207671_10000001 Ga0207671_10000001382 269
95 3300025914 Ga0207671_10020295 Ga0207671_100202952 269
96 3300025924 Ga0207694_10000312 Ga0207694_1000031237 269
97 3300025924 Ga0207694_10385649 Ga0207694_103856491 269
98 3300025932 Ga0207690_10011500 Ga0207690_100115005 269
99 3300025940 Ga0207691_10085935 Ga0207691_100859352 269
100 3300025941 Ga0207711_10000289 Ga0207711_1000028911 269
101 3300025949 Ga0207667_10015647 Ga0207667_100156479 269
102 3300025949 Ga0207667_10018969 Ga0207667_100189698 269
103 3300025949 Ga0207667_10046183 Ga0207667_100461834 269
104 3300025949 Ga0207667_10174076 Ga0207667_101740762 269
105 3300025981 Ga0207640_10199131 Ga0207640_101991311 269
106 3300026023 Ga0207677_10024778 Ga0207677_100247782 269
107 3300026041 Ga0207639_10026825 Ga0207639_100268254 269
108 3300026041 Ga0207639_10056277 Ga0207639_100562772 269
109 3300026067 Ga0207678_10011199 Ga0207678_100111998 269
110 3300026078 Ga0207702_10054206 Ga0207702_100542064 269
111 3300026088 Ga0207641_10112420 Ga0207641_101124203 269
112 3300026088 Ga0207641_10236406 Ga0207641_102364062 269
113 3300026095 Ga0207676_10306973 Ga0207676_103069732 269
114 3300026116 Ga0207674_10003568 Ga0207674_1000356813 269
115 3300031901 Ga0307406_10024069 Ga0307406_100240693 269
116 3300032002 Ga0307416_100330476 Ga0307416_1003304761 269
117 3300046453 Ga0495627_008396 Ga0495627_008396_170_985 269
118 3300046460 Ga0495638_0038719 Ga0495638_0038719_704_1555 269
119 3300048090 Ga0495615_0023466 Ga0495615_0023466_550_1368 269
120 3300048920 Ga0496117_0002228 Ga0496117_0002228_4012_4821 269
121 3300048921 Ga0496118_0029124 Ga0496118_0029124_178_987 269
122 3300048922 Ga0496119_0045324 Ga0496119_0045324_1809_2618 269
123 3300048922 Ga0496119_0163591 Ga0496119_0163591_120_971 269
124 3300048922 Ga0496119_0173420 Ga0496119_0173420_115_939 269
125 3300048923 Ga0496120_0044302 Ga0496120_0044302_1520_2371 269
126 3300048924 Ga0496121_0000289 Ga0496121_0000289_89148_89981 269
127 3300048925 Ga0496122_0019171 Ga0496122_0019171_4121_4948 269
128 3300048925 Ga0496122_0254172 Ga0496122_0254172_137_964 269
129 3300048928 Ga0496125_0004641 Ga0496125_0004641_1918_2745 269
130 3300048928 Ga0496125_0239454 Ga0496125_0239454_207_1016 269
131 3300048929 Ga0496126_0009669 Ga0496126_0009669_4390_5202 269
132 3300048929 Ga0496126_0011124 Ga0496126_0011124_4253_5074 269
133 3300048929 Ga0496126_0173337 Ga0496126_0173337_318_1127 269
134 3300048929 Ga0496126_0206362 Ga0496126_0206362_734_1594 269
135 3300048929 Ga0496126_0219339 Ga0496126_0219339_614_1441 269
136 3300049568 Ga0501031_0190156 Ga0501031_0190156_138_992 269
137 3300049571 Ga0501034_0015687 Ga0501034_0015687_1889_2716 269
138 3300049579 Ga0501043_0049017 Ga0501043_0049017_482_1336 269
139 3300049581 Ga0501047_0061499 Ga0501047_0061499_1305_2159 269
140 3300049823 Ga0501044_0016667 Ga0501044_0016667_4898_5752 269
141 3300050491 nmdc:mga00v17_94145_c1 nmdc:mga00v17_94145_c1_982_1791 269
142 3300050492 nmdc:mga0yw44_150468_c1 nmdc:mga0yw44_150468_c1_592_1419 269
143 3300053093 Ga0500651_0000764 Ga0500651_0000764_5089_5916 269
144 3300053148 Ga0500590_003647 Ga0500590_003647_5811_6638 269
145 iso_pu_bacteria 2643221572 2643875765 269
146 iso_pu_bacteria 2643221619 2644114234 269
147 iso_pu_bacteria 2643221632 2644182901 269
148 iso_pu_bacteria 2643221649 2644277396 269
149 iso_pu_bacteria 2643221669 2644382820 269
150 iso_pu_bacteria 2643221724 2644679552 269
151 iso_pu_bacteria 2721755702 2723641596 269
152 iso_pu_bacteria 2728369380 2730229061 269
153 iso_pu_bacteria 2747842429 2747951929 269
154 iso_pu_bacteria 2808606372 2808901544 269
155 iso_pu_bacteria 2935409751 2935411023 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

28

275

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8i-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.912 4 263
5h8l-assembly1.cif.gz_A crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.912 4 263
4hgd-assembly2.cif.gz_B structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand 0.9105 6 263
5h8k-assembly1.cif.gz_A crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9101 4 263
4hgd-assembly1.cif.gz_D structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand 0.9091 7 263
ID Description Score Start End Superfamily
af_P0DP64_2_182_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9683 83 265 3.60.110.10
af_P0DP64_2_182_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.963 83 265 3.60.110.10
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.94 6 265 3.60.110.10
af_P9WJ01_1_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9365 8 268 3.60.110.10
af_Q8VDK1_45_315_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9309 10 263 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2M9BWL9-F1-model_v4 Putative amidohydrolase 0.9938 6 269 GO:0016787
AF-A0A7Y9ES92-F1-model_v4 Putative amidohydrolase 0.9916 28 269 GO:0016787
AF-A0A4R4ZNA9-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9899 9 239 GO:0016787
AF-A0A3A5MKE9-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9877 3 269 GO:0016787
AF-A0A2W1RXV6-F1-model_v4 deleted 0.9873 4 269

Feature Viewer

pLDDT pTM Quality
94.78 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map