F222380

General Info

Members Datasets Scaffolds Average Seq Length
155 120 148 121

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1011737|Ga0209233_10117374
Length 122
Sequence MRDYKKLDVWKKAHMLTKQVYSDIVPLMPADKKFALTSQLRRSAYSIPLNINIVEGCGRNTDKDFAHFLDTALGSALEVKYSCFLIYDLNYISEGVYNQINTGVNEIKAMLISFIKYLRDEK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2818991437 Pedobacter terrae 518 Isolate Unclassified
4 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
5 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
118 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
119 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
120 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 1.94
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.84
Nodule 0
Rhizoplane 1.29
Rhizosphere 73.55
Stem 0
Stem Tuber 0
Unclassified 10.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1020236 3300001915 Bacteria 1047
2 JGI24739J22299_10004155 3300001989 Bacteria 5539
3 JGI25162J39368_1001318 3300002737 Bacteria 13921
4 JGI25164J39214_1000855 3300002772 Bacteria 10454
5 JGI25165J46597_1001619 3300003214 Bacteria 10724
6 JGI25165J46597_1024259 3300003214 Bacteria 787
7 rootH1_10034281 3300003316 Bacteria 2378
8 rootH1_10117157 3300003323 Bacteria 1382
9 rootH1_10207268 3300003323 Bacteria 3154
10 Ga0055529_1048403 3300003763 Bacteria 510
11 Ga0055536_1000010 3300003781 Bacteria 304614
12 Ga0055530_10002214 3300003791 Bacteria 12844
13 Ga0058863_11283967 3300004799 Bacteria 1620
14 Ga0058862_12893042 3300004803 Bacteria 4420
15 Ga0065714_10007893 3300005288 Bacteria 4048
16 Ga0065714_10068951 3300005288 Bacteria 4451
17 Ga0065714_10203237 3300005288 Bacteria 889
18 Ga0070658_10229145 3300005327 Bacteria 1573
19 Ga0070677_10848183 3300005333 Bacteria 525
20 Ga0070680_100010203 3300005336 Bacteria 7242
21 Ga0070667_100453338 3300005367 Bacteria 1172
22 Ga0070681_10355997 3300005458 Bacteria 1374
23 Ga0070679_100042689 3300005530 Bacteria 4516
24 Ga0068855_100000508 3300005563 Bacteria 48055
25 Ga0068855_100373724 3300005563 Bacteria 1566
26 Ga0068856_100113608 3300005614 Bacteria 2706
27 Ga0068852_100139862 3300005616 Bacteria 2239
28 Ga0068852_100465267 3300005616 Bacteria 1254
29 Ga0075366_10716307 3300006195 Bacteria 621
30 Ga0068871_100869684 3300006358 Bacteria 834
31 Ga0105244_10085961 3300009036 Bacteria 1551
32 Ga0105240_10083971 3300009093 Bacteria 3906
33 Ga0105240_10283066 3300009093 Bacteria 1904
34 Ga0105240_10595105 3300009093 Bacteria 1218
35 Ga0105240_11528336 3300009093 Bacteria 699
36 Ga0105242_10217597 3300009176 Bacteria 1705
37 Ga0105237_11441102 3300009545 Bacteria 695
38 Ga0105238_11109378 3300009551 Bacteria 814
39 Ga0105238_13067777 3300009551 Unclassified 501
40 Ga0157371_10000046 3300013102 Bacteria 187304
41 Ga0157370_10865457 3300013104 Bacteria 821
42 Ga0157369_10002502 3300013105 Bacteria 22008
43 Ga0157374_10190939 3300013296 Bacteria 2004
44 Ga0157374_10583549 3300013296 Bacteria 1127
45 Ga0157378_10525266 3300013297 Bacteria 1186
46 Ga0157378_10548752 3300013297 Bacteria 1161
47 Ga0163162_10033604 3300013306 Bacteria 5098
48 Ga0163162_10128629 3300013306 Bacteria 2641
49 Ga0163162_11776167 3300013306 Bacteria 705
50 Ga0157372_10188061 3300013307 Bacteria 2391
51 Ga0157372_11439781 3300013307 Bacteria 794
52 Ga0157375_10118550 3300013308 Bacteria 2753
53 Ga0157375_11737906 3300013308 Unclassified 739
54 Ga0163163_10707099 3300014325 Unclassified 1071
55 Ga0163163_12319036 3300014325 Unclassified 595
56 Ga0157376_10287936 3300014969 Bacteria 1550
57 Ga0157376_12449666 3300014969 Bacteria 561
58 Ga0157376_13126051 3300014969 Bacteria 501
59 Ga0183373_1008 3300015682 Bacteria 255339
60 Ga0206351_10084519 3300020077 Bacteria 1494
61 Ga0209563_108195 3300025230 Bacteria 1661
62 Ga0207427_100103 3300025231 Bacteria 119618
63 Ga0209437_100101 3300025233 Bacteria 226668
64 Ga0209258_111352 3300025242 Bacteria 1126
65 Ga0209026_1002049 3300025250 Bacteria 7962
66 Ga0209233_1000124 3300025261 Bacteria 226743
67 Ga0209233_1011737 3300025261 Bacteria 2572
68 Ga0209455_1005644 3300025272 Bacteria 3825
69 Ga0209676_1000009 3300025292 Bacteria 981719
70 Ga0209050_1000103 3300025298 Bacteria 229225
71 Ga0207655_1052253 3300025728 Bacteria 1645
72 Ga0207705_10184928 3300025909 Bacteria 1574
73 Ga0207707_10159547 3300025912 Bacteria 1972
74 Ga0207695_10347924 3300025913 Bacteria 1370
75 Ga0207695_10509674 3300025913 Bacteria 1085
76 Ga0207695_10908173 3300025913 Bacteria 760
77 Ga0207695_11261179 3300025913 Bacteria 619
78 Ga0207671_10023732 3300025914 Bacteria 4623
79 Ga0207652_10039601 3300025921 Bacteria 4000
80 Ga0207667_10009017 3300025949 Bacteria 11800
81 Ga0207640_10663411 3300025981 Unclassified 890
82 Ga0207658_10778532 3300025986 Bacteria 868
83 Ga0207678_10046031 3300026067 Bacteria 3773
84 Ga0207702_10024798 3300026078 Bacteria 4975
85 Ga0207698_10827202 3300026142 Bacteria 930
86 Ga0207698_10975582 3300026142 Bacteria 857
87 Ga0307515_10000927 3300028794 Bacteria 67260
88 Ga0307515_10001771 3300028794 Bacteria 48123
89 Ga0307512_10197951 3300030522 Bacteria 1094
90 Ga0307513_10154196 3300031456 Bacteria 2200
91 Ga0307408_100000534 3300031548 Bacteria 32864
92 Ga0307516_10568152 3300031730 Bacteria 788
93 Ga0307405_10118925 3300031731 Bacteria 1804
94 Ga0307412_10000154 3300031911 Bacteria 49488
95 Ga0307412_10033341 3300031911 Bacteria 3272
96 Ga0307412_12018916 3300031911 Bacteria 534
97 Ga0307416_100000032 3300032002 Bacteria 156777
98 Ga0307416_100312803 3300032002 Bacteria 1568
99 Ga0307414_10119413 3300032004 Bacteria 2024
100 Ga0307411_10577682 3300032005 Bacteria 963
101 Ga0307507_10000064 3300033179 Bacteria 161226
102 Ga0373937_0938544 3300036401 Unclassified 814
103 Ga0395900_0422821 3300037418 Bacteria 1293
104 Ga0395898_0520389 3300037466 Bacteria 1131
105 Ga0436365_0706277 3300039437 Bacteria 2076
106 Ga0451802_2048718 3300041460 Bacteria 617
107 Ga0451853_2045046 3300041512 Bacteria 531
108 Ga0439445_0025031 3300042004 Bacteria 1521
109 Ga0439448_0001740 3300042005 Bacteria 5754
110 Ga0439455_0022337 3300042012 Bacteria 1516
111 Ga0466972_0000280 3300044658 Bacteria 31990
112 Ga0466972_0022933 3300044658 Bacteria 3106
113 Ga0466957_0001670 3300044842 Bacteria 11655
114 Ga0466957_0007722 3300044842 Bacteria 6085
115 Ga0495638_0259491 3300046460 Bacteria 954
116 Ga0495585_0000079 3300046492 Bacteria 100159
117 Ga0495583_0114072 3300046506 Bacteria 1143
118 Ga0495606_0115239 3300046507 Bacteria 1616
119 Ga0495608_0379281 3300046511 Unclassified 867
120 Ga0495610_0000992 3300046512 Bacteria 26173
121 Ga0495616_0015547 3300046513 Bacteria 4231
122 Ga0495637_0129592 3300046520 Bacteria 964
123 Ga0495644_0018713 3300046523 Bacteria 2643
124 Ga0495648_0280839 3300046524 Bacteria 789
125 Ga0495642_0151261 3300046528 Bacteria 1004
126 Ga0495652_0467388 3300046529 Bacteria 880
127 Ga0495633_0000056 3300046558 Bacteria 149334
128 Ga0495625_0019973 3300046660 Bacteria 5182
129 Ga0495625_0033793 3300046660 Bacteria 3777
130 Ga0495625_0250548 3300046660 Bacteria 1150
131 Ga0495625_0851002 3300046660 Bacteria 526
132 Ga0495657_0269262 3300046675 Bacteria 1022
133 Ga0495599_0572076 3300046678 Bacteria 660
134 Ga0495636_0331655 3300047318 Bacteria 716
135 Ga0495672_0002547 3300047320 Bacteria 16619
136 Ga0495687_002135 3300047443 Bacteria 16518
137 Ga0495681_0105720 3300047470 Bacteria 1224
138 Ga0495678_021009 3300049459 Bacteria 2882
139 Ga0501036_1698520 3300049572 Unclassified 509
140 Ga0501047_1179954 3300049581 Unclassified 579
141 Ga0501223_000355 3300049663 Bacteria 11289
142 Ga0501225_0000448 3300049705 Bacteria 12856
143 Ga0500578_0000010 3300053086 Bacteria 217642
144 Ga0500578_0118768 3300053086 Bacteria 1663
145 Ga0500608_018150 3300053122 Bacteria 3207
146 Ga0500618_000003 3300053125 Bacteria 338706
147 Ga0500618_032760 3300053125 Bacteria 1214
148 Ga0500619_106583 3300053154 Bacteria 953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10217597 Ga0105242_102175972 113
2 3300032002 Ga0307416_100000032 Ga0307416_10000003218 115
3 iso_pu_bacteria 2599185184 2599478632 115
4 iso_pu_bacteria 2738541302 2738854140 115
5 iso_pu_bacteria 2818991437 2819545530 115
6 iso_pu_bacteria 2849281842 2849283554 115
7 iso_pu_bacteria 2857627736 2857630509 115
8 iso_pu_bacteria 2928147474 2928149515 115
9 iso_pu_bacteria 2954016120 2954021017 115
10 3300005333 Ga0070677_10848183 Ga0070677_108481831 118
11 3300006358 Ga0068871_100869684 Ga0068871_1008696842 118
12 3300013297 Ga0157378_10525266 Ga0157378_105252662 118
13 3300013306 Ga0163162_10128629 Ga0163162_101286292 118
14 3300013307 Ga0157372_11439781 Ga0157372_114397812 118
15 3300013308 Ga0157375_11737906 Ga0157375_117379061 118
16 3300014325 Ga0163163_12319036 Ga0163163_123190361 118
17 3300014969 Ga0157376_10287936 Ga0157376_102879362 118
18 3300030522 Ga0307512_10197951 Ga0307512_101979512 118
19 3300039437 Ga0436365_0706277 Ga0436365_0706277_687_1043 118
20 3300044658 Ga0466972_0022933 Ga0466972_0022933_1652_2008 118
21 3300044842 Ga0466957_0007722 Ga0466957_0007722_5560_6000 118
22 3300046528 Ga0495642_0151261 Ga0495642_0151261_468_824 118
23 3300046660 Ga0495625_0851002 Ga0495625_0851002_113_469 118
24 3300047318 Ga0495636_0331655 Ga0495636_0331655_201_557 118
25 3300049705 Ga0501225_0000448 Ga0501225_0000448_11234_11590 118
26 3300053086 Ga0500578_0000010 Ga0500578_0000010_143341_143697 118
27 3300001915 JGI24741J21665_1020236 JGI24741J21665_10202362 119
28 3300001989 JGI24739J22299_10004155 JGI24739J22299_100041556 119
29 3300002737 JGI25162J39368_1001318 JGI25162J39368_10013187 119
30 3300002772 JGI25164J39214_1000855 JGI25164J39214_10008559 119
31 3300003214 JGI25165J46597_1001619 JGI25165J46597_100161916 119
32 3300003214 JGI25165J46597_1024259 JGI25165J46597_10242592 119
33 3300003316 rootH1_10034281 rootH1_100342814 119
34 3300003323 rootH1_10117157 rootH1_101171572 119
35 3300003323 rootH1_10207268 rootH1_102072683 119
36 3300003763 Ga0055529_1048403 Ga0055529_10484031 119
37 3300003781 Ga0055536_1000010 Ga0055536_1000010128 119
38 3300003791 Ga0055530_10002214 Ga0055530_100022147 119
39 3300004799 Ga0058863_11283967 Ga0058863_112839672 119
40 3300004803 Ga0058862_12893042 Ga0058862_128930425 119
41 3300005288 Ga0065714_10007893 Ga0065714_100078935 119
42 3300005288 Ga0065714_10068951 Ga0065714_100689515 119
43 3300005288 Ga0065714_10203237 Ga0065714_102032372 119
44 3300005327 Ga0070658_10229145 Ga0070658_102291452 119
45 3300005336 Ga0070680_100010203 Ga0070680_1000102035 119
46 3300005367 Ga0070667_100453338 Ga0070667_1004533382 119
47 3300005458 Ga0070681_10355997 Ga0070681_103559972 119
48 3300005530 Ga0070679_100042689 Ga0070679_1000426892 119
49 3300005563 Ga0068855_100000508 Ga0068855_10000050816 119
50 3300005563 Ga0068855_100373724 Ga0068855_1003737242 119
51 3300005614 Ga0068856_100113608 Ga0068856_1001136084 119
52 3300005616 Ga0068852_100139862 Ga0068852_1001398623 119
53 3300005616 Ga0068852_100465267 Ga0068852_1004652672 119
54 3300006195 Ga0075366_10716307 Ga0075366_107163071 119
55 3300009036 Ga0105244_10085961 Ga0105244_100859612 119
56 3300009093 Ga0105240_10083971 Ga0105240_100839716 119
57 3300009093 Ga0105240_10283066 Ga0105240_102830662 119
58 3300009093 Ga0105240_10595105 Ga0105240_105951052 119
59 3300009093 Ga0105240_11528336 Ga0105240_115283362 119
60 3300009545 Ga0105237_11441102 Ga0105237_114411022 119
61 3300009551 Ga0105238_11109378 Ga0105238_111093782 119
62 3300009551 Ga0105238_13067777 Ga0105238_130677771 119
63 3300013102 Ga0157371_10000046 Ga0157371_1000004693 119
64 3300013104 Ga0157370_10865457 Ga0157370_108654572 119
65 3300013105 Ga0157369_10002502 Ga0157369_100025022 119
66 3300013296 Ga0157374_10190939 Ga0157374_101909392 119
67 3300013296 Ga0157374_10583549 Ga0157374_105835492 119
68 3300013297 Ga0157378_10548752 Ga0157378_105487522 119
69 3300013306 Ga0163162_10033604 Ga0163162_100336042 119
70 3300013306 Ga0163162_11776167 Ga0163162_117761671 119
71 3300013307 Ga0157372_10188061 Ga0157372_101880613 119
72 3300013308 Ga0157375_10118550 Ga0157375_101185502 119
73 3300014325 Ga0163163_10707099 Ga0163163_107070992 119
74 3300014969 Ga0157376_12449666 Ga0157376_124496661 119
75 3300014969 Ga0157376_13126051 Ga0157376_131260512 119
76 3300015682 Ga0183373_1008 Ga0183373_1008167 119
77 3300020077 Ga0206351_10084519 Ga0206351_100845192 119
78 3300025230 Ga0209563_108195 Ga0209563_1081952 119
79 3300025231 Ga0207427_100103 Ga0207427_10010326 119
80 3300025233 Ga0209437_100101 Ga0209437_10010147 119
81 3300025242 Ga0209258_111352 Ga0209258_1113522 119
82 3300025250 Ga0209026_1002049 Ga0209026_10020497 119
83 3300025261 Ga0209233_1000124 Ga0209233_1000124189 119
84 3300025261 Ga0209233_1011737 Ga0209233_10117374 119
85 3300025272 Ga0209455_1005644 Ga0209455_10056443 119
86 3300025292 Ga0209676_1000009 Ga0209676_1000009747 119
87 3300025298 Ga0209050_1000103 Ga0209050_1000103126 119
88 3300025728 Ga0207655_1052253 Ga0207655_10522532 119
89 3300025909 Ga0207705_10184928 Ga0207705_101849282 119
90 3300025912 Ga0207707_10159547 Ga0207707_101595473 119
91 3300025913 Ga0207695_10347924 Ga0207695_103479242 119
92 3300025913 Ga0207695_10509674 Ga0207695_105096742 119
93 3300025913 Ga0207695_10908173 Ga0207695_109081732 119
94 3300025913 Ga0207695_11261179 Ga0207695_112611792 119
95 3300025914 Ga0207671_10023732 Ga0207671_100237325 119
96 3300025921 Ga0207652_10039601 Ga0207652_100396012 119
97 3300025949 Ga0207667_10009017 Ga0207667_100090176 119
98 3300025981 Ga0207640_10663411 Ga0207640_106634112 119
99 3300025986 Ga0207658_10778532 Ga0207658_107785322 119
100 3300026067 Ga0207678_10046031 Ga0207678_100460312 119
101 3300026078 Ga0207702_10024798 Ga0207702_100247982 119
102 3300026142 Ga0207698_10827202 Ga0207698_108272022 119
103 3300026142 Ga0207698_10975582 Ga0207698_109755822 119
104 3300028794 Ga0307515_10000927 Ga0307515_1000092719 119
105 3300028794 Ga0307515_10001771 Ga0307515_1000177134 119
106 3300031456 Ga0307513_10154196 Ga0307513_101541961 119
107 3300031548 Ga0307408_100000534 Ga0307408_10000053415 119
108 3300031730 Ga0307516_10568152 Ga0307516_105681522 119
109 3300031731 Ga0307405_10118925 Ga0307405_101189251 119
110 3300031911 Ga0307412_10000154 Ga0307412_1000015442 119
111 3300031911 Ga0307412_10033341 Ga0307412_100333413 119
112 3300031911 Ga0307412_12018916 Ga0307412_120189162 119
113 3300032002 Ga0307416_100312803 Ga0307416_1003128031 119
114 3300032004 Ga0307414_10119413 Ga0307414_101194132 119
115 3300032005 Ga0307411_10577682 Ga0307411_105776822 119
116 3300033179 Ga0307507_10000064 Ga0307507_1000006426 119
117 3300036401 Ga0373937_0938544 Ga0373937_0938544_342_710 119
118 3300037418 Ga0395900_0422821 Ga0395900_0422821_484_843 119
119 3300037466 Ga0395898_0520389 Ga0395898_0520389_441_800 119
120 3300041460 Ga0451802_2048718 Ga0451802_2048718_201_596 119
121 3300041512 Ga0451853_2045046 Ga0451853_2045046_63_428 119
122 3300042004 Ga0439445_0025031 Ga0439445_0025031_355_717 119
123 3300042005 Ga0439448_0001740 Ga0439448_0001740_5194_5553 119
124 3300042012 Ga0439455_0022337 Ga0439455_0022337_85_444 119
125 3300044658 Ga0466972_0000280 Ga0466972_0000280_3606_3965 119
126 3300044842 Ga0466957_0001670 Ga0466957_0001670_65_427 119
127 3300046460 Ga0495638_0259491 Ga0495638_0259491_192_557 119
128 3300046492 Ga0495585_0000079 Ga0495585_0000079_6187_6549 119
129 3300046506 Ga0495583_0114072 Ga0495583_0114072_19_384 119
130 3300046507 Ga0495606_0115239 Ga0495606_0115239_1239_1604 119
131 3300046511 Ga0495608_0379281 Ga0495608_0379281_179_556 119
132 3300046512 Ga0495610_0000992 Ga0495610_0000992_3916_4284 119
133 3300046513 Ga0495616_0015547 Ga0495616_0015547_2742_3107 119
134 3300046520 Ga0495637_0129592 Ga0495637_0129592_443_805 119
135 3300046523 Ga0495644_0018713 Ga0495644_0018713_1258_1620 119
136 3300046524 Ga0495648_0280839 Ga0495648_0280839_23_388 119
137 3300046529 Ga0495652_0467388 Ga0495652_0467388_351_716 119
138 3300046558 Ga0495633_0000056 Ga0495633_0000056_46425_46790 119
139 3300046660 Ga0495625_0019973 Ga0495625_0019973_2900_3322 119
140 3300046660 Ga0495625_0033793 Ga0495625_0033793_395_760 119
141 3300046660 Ga0495625_0250548 Ga0495625_0250548_766_1131 119
142 3300046675 Ga0495657_0269262 Ga0495657_0269262_30_398 119
143 3300046678 Ga0495599_0572076 Ga0495599_0572076_80_448 119
144 3300047320 Ga0495672_0002547 Ga0495672_0002547_3329_3694 119
145 3300047443 Ga0495687_002135 Ga0495687_002135_1953_2315 119
146 3300047470 Ga0495681_0105720 Ga0495681_0105720_482_850 119
147 3300049459 Ga0495678_021009 Ga0495678_021009_865_1230 119
148 3300049572 Ga0501036_1698520 Ga0501036_1698520_77_442 119
149 3300049581 Ga0501047_1179954 Ga0501047_1179954_66_431 119
150 3300049663 Ga0501223_000355 Ga0501223_000355_10915_11277 119
151 3300053086 Ga0500578_0118768 Ga0500578_0118768_190_549 119
152 3300053122 Ga0500608_018150 Ga0500608_018150_1531_1896 119
153 3300053125 Ga0500618_000003 Ga0500618_000003_101562_101927 119
154 3300053125 Ga0500618_032760 Ga0500618_032760_325_687 119
155 3300053154 Ga0500619_106583 Ga0500619_106583_166_531 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

5

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9678 2 115
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9636 2 116
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9508 2 115
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9474 2 116
2f6m-assembly2.cif.gz_C structure of a vps23-c:vps28-n subcomplex 0.9268 57 119
ID Description Score Start End Superfamily
af_A0A1D6PIN9_172_240_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9863 61 113 1.10.287.660
af_Q10QR4_157_230_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9836 60 117 1.10.287.660
af_A0A1D6JR08_188_264_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9832 60 118 1.10.287.660
af_X1WEV5_108_185_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9696 57 118 1.10.287.660
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9678 2 115 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A7D4PZA8-F1-model_v4 Four helix bundle protein 1 1 119
AF-A0A5D8YHH8-F1-model_v4 Four helix bundle protein 0.9983 1 118
AF-A0A3D3P7M2-F1-model_v4 Four helix bundle protein 0.9972 1 117
AF-A0A562U4R4-F1-model_v4 Four helix bundle protein 0.9959 1 118
AF-A0A3E0G4M1-F1-model_v4 deleted 0.9932 1 117

Feature Viewer

pLDDT pTM Quality
97.22 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map