F222826

General Info

Members Datasets Scaffolds Average Seq Length
155 102 155 154

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0297243|Ga0439465_0297243_86_577
Length 156
Sequence MPENFQSRKFRWLFNFFPAYRGTGGRVVYIADDWHEVRVKLPLNWRTRNYVGTIAADPIYMLMLMRILGDGYVVWDKAAKVRFRKPGKATLYADFRLRRDEIAEIRSLAENARSIDRIYNVELKDNSGVIYAEIEKTLYISKKRGIDELLGTGVHI

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10322556 3300005295 Unclassified 964
2 Ga0070658_10027693 3300005327 Bacteria 4548
3 Ga0068869_100048126 3300005334 Bacteria 3082
4 Ga0068869_100390067 3300005334 Bacteria 1143
5 Ga0070680_100426390 3300005336 Bacteria 1132
6 Ga0070682_100289085 3300005337 Bacteria 1198
7 Ga0070675_100051130 3300005354 Archaea 3395
8 Ga0070671_100247802 3300005355 Archaea 1513
9 Ga0070673_100400071 3300005364 Bacteria 1228
10 Ga0070688_100812981 3300005365 Archaea 732
11 Ga0070703_10379528 3300005406 Bacteria 610
12 Ga0070701_10013240 3300005438 Bacteria 3747
13 Ga0070711_100428872 3300005439 Bacteria 1079
14 Ga0070705_100002442 3300005440 Bacteria 9343
15 Ga0070694_100072442 3300005444 Bacteria 2377
16 Ga0070694_100149019 3300005444 Unclassified 1707
17 Ga0070694_100822924 3300005444 Archaea 762
18 Ga0070694_100937214 3300005444 Bacteria 716
19 Ga0070708_100204587 3300005445 Bacteria 1849
20 Ga0070708_100773087 3300005445 Unclassified 903
21 Ga0070662_100000205 3300005457 Bacteria 34590
22 Ga0070681_10180114 3300005458 Bacteria 2035
23 Ga0070685_10001133 3300005466 Bacteria 14266
24 Ga0070706_100001689 3300005467 Bacteria 22975
25 Ga0070706_100013241 3300005467 Bacteria 7630
26 Ga0070706_100414153 3300005467 Unclassified 1254
27 Ga0070707_100004464 3300005468 Bacteria 13104
28 Ga0070707_100005887 3300005468 Bacteria 11435
29 Ga0070698_100000289 3300005471 Bacteria 51272
30 Ga0070698_100001513 3300005471 Bacteria 25768
31 Ga0070698_100034646 3300005471 Bacteria 5225
32 Ga0070698_100046091 3300005471 Bacteria 4459
33 Ga0070698_100125602 3300005471 Bacteria 2523
34 Ga0070699_100001187 3300005518 Bacteria 24088
35 Ga0070699_100126971 3300005518 Archaea 2246
36 Ga0070699_100792476 3300005518 Bacteria 867
37 Ga0070697_100015284 3300005536 Bacteria 6025
38 Ga0070697_100023011 3300005536 Unclassified 4956
39 Ga0070697_100414263 3300005536 Bacteria 1170
40 Ga0070672_100160050 3300005543 Bacteria 1867
41 Ga0070686_100219081 3300005544 Bacteria 1374
42 Ga0070686_100284905 3300005544 Unclassified 1220
43 Ga0070686_100350190 3300005544 Bacteria 1109
44 Ga0070695_100000838 3300005545 Bacteria 16590
45 Ga0070696_100273468 3300005546 Bacteria 1285
46 Ga0070696_100317017 3300005546 Unclassified 1199
47 Ga0070704_100000546 3300005549 Bacteria 18015
48 Ga0068859_100011471 3300005617 Bacteria 8910
49 Ga0068862_100028578 3300005844 Bacteria 4697
50 Ga0068862_100051582 3300005844 Bacteria 3519
51 Ga0097621_100321512 3300006237 Bacteria 1371
52 Ga0068871_100257146 3300006358 Bacteria 1522
53 Ga0075428_100256663 3300006844 Bacteria 1883
54 Ga0075430_100056344 3300006846 Bacteria 3305
55 Ga0075431_100376232 3300006847 Bacteria 1425
56 Ga0075431_100714801 3300006847 Bacteria 979
57 Ga0075434_100060412 3300006871 Bacteria 3770
58 Ga0075429_100256601 3300006880 Bacteria 1531
59 Ga0075429_100386592 3300006880 Bacteria 1225
60 Ga0097620_100011471 3300006931 Bacteria 8910
61 Ga0097620_100419260 3300006931 Bacteria 1435
62 Ga0075435_100038384 3300007076 Unclassified 3818
63 Ga0114129_10007328 3300009147 Bacteria 15702
64 Ga0105243_12191716 3300009148 Bacteria 589
65 Ga0105249_10095942 3300009553 Unclassified 2781
66 Ga0105246_10053180 3300011119 Bacteria 2786
67 Ga0157378_10000013 3300013297 Bacteria 151930
68 Ga0157378_10001593 3300013297 Bacteria 20528
69 Ga0157378_11282018 3300013297 Bacteria 773
70 Ga0157375_10000009 3300013308 Bacteria 366440
71 Ga0157380_11044320 3300014326 Archaea 853
72 Ga0157380_11097975 3300014326 Bacteria 834
73 Ga0207653_10184737 3300025885 Bacteria 781
74 Ga0207699_10404393 3300025906 Bacteria 973
75 Ga0207705_10092459 3300025909 Bacteria 2216
76 Ga0207684_10004085 3300025910 Bacteria 13914
77 Ga0207684_10032216 3300025910 Unclassified 4458
78 Ga0207684_10038201 3300025910 Unclassified 4074
79 Ga0207660_10879505 3300025917 Bacteria 731
80 Ga0207662_10211859 3300025918 Bacteria 1258
81 Ga0207646_10016062 3300025922 Bacteria 7034
82 Ga0207646_10138487 3300025922 Bacteria 2192
83 Ga0207659_10065699 3300025926 Archaea 2630
84 Ga0207706_10000268 3300025933 Bacteria 56719
85 Ga0207691_10089925 3300025940 Bacteria 2752
86 Ga0207689_10011362 3300025942 Bacteria 7634
87 Ga0207640_10478862 3300025981 Bacteria 1032
88 Ga0210002_1006343 3300027617 Bacteria 1784
89 Ga0268265_10012952 3300028380 Bacteria 5661
90 Ga0268265_12149904 3300028380 Bacteria 565
91 Ga0307408_100045861 3300031548 Bacteria 3124
92 Ga0307408_100089659 3300031548 Bacteria 2319
93 Ga0307408_100142105 3300031548 Bacteria 1885
94 Ga0307405_10116365 3300031731 Bacteria 1821
95 Ga0307413_10007304 3300031824 Bacteria 5120
96 Ga0307413_10023508 3300031824 Bacteria 3341
97 Ga0307413_10097660 3300031824 Bacteria 1932
98 Ga0307410_10002540 3300031852 Bacteria 8834
99 Ga0307410_10020822 3300031852 Bacteria 4022
100 Ga0307410_10035046 3300031852 Bacteria 3256
101 Ga0307406_10540780 3300031901 Unclassified 951
102 Ga0307406_11037658 3300031901 Unclassified 705
103 Ga0307407_10038798 3300031903 Bacteria 2643
104 Ga0307407_10161096 3300031903 Bacteria 1468
105 Ga0307407_10284417 3300031903 Bacteria 1147
106 Ga0307409_100334086 3300031995 Bacteria 1423
107 Ga0307409_100516536 3300031995 Bacteria 1166
108 Ga0307416_100214604 3300032002 Unclassified 1839
109 Ga0307416_100371228 3300032002 Bacteria 1457
110 Ga0307416_102122009 3300032002 Unclassified 664
111 Ga0307411_10012438 3300032005 Bacteria 4644
112 Ga0307411_10060311 3300032005 Bacteria 2519
113 Ga0307411_10171551 3300032005 Bacteria 1636
114 Ga0307411_10314739 3300032005 Unclassified 1261
115 Ga0307411_10720912 3300032005 Unclassified 871
116 Ga0307411_11112943 3300032005 Unclassified 712
117 Ga0307415_100204883 3300032126 Bacteria 1568
118 Ga0307415_102095692 3300032126 Unclassified 552
119 Ga0373943_0024259 3300035170 Bacteria 2827
120 Ga0373943_0451150 3300035170 Unclassified 747
121 Ga0373955_0200916 3300035172 Unclassified 1187
122 Ga0373925_0135912 3300037068 Bacteria 1921
123 Ga0436364_0279310 3300037853 Bacteria 6165
124 Ga0439447_116085 3300041407 Unclassified 614
125 Ga0439453_0173269 3300041408 Unclassified 523
126 Ga0439465_0297243 3300041413 Unclassified 604
127 Ga0453683_0280186 3300044673 Bacteria 1065
128 Ga0466961_0000975 3300044693 Bacteria 17740
129 Ga0453684_0000927 3300044712 Bacteria 96998
130 Ga0453684_0023275 3300044712 Bacteria 9137
131 Ga0453684_0719689 3300044712 Bacteria 1083
132 Ga0451576_0587625 3300045051 Bacteria 1170
133 Ga0466967_2342326 3300045976 Archaea 529
134 Ga0495580_0000017 3300046472 Bacteria 93605
135 Ga0495639_0005939 3300046475 Bacteria 5254
136 Ga0495628_0224243 3300046516 Bacteria 1411
137 Ga0495632_0005112 3300046519 Bacteria 8763
138 Ga0495647_0132449 3300046681 Unclassified 1057
139 Ga0495589_0297131 3300046794 Bacteria 749
140 Ga0495675_0566919 3300047444 Unclassified 646
141 Ga0495679_016231 3300047446 Bacteria 2698
142 Ga0495602_0179470 3300048088 Bacteria 1635
143 Ga0496106_0139934 3300048909 Bacteria 1903
144 Ga0501235_063346 3300049669 Bacteria 868
145 nmdc:mga05p37_347282_c1 3300050507 Bacteria 1748
146 nmdc:mga09592_280375_c1 3300050508 Bacteria 1445
147 nmdc:mga09592_302283_c1 3300050508 Bacteria 1387
148 nmdc:mga06r32_399039_c1 3300050510 Bacteria 1357
149 nmdc:mga08y16_869062_c1 3300050511 Unclassified 890
150 nmdc:mga0n895_509685_c1 3300050512 Archaea 1211
151 nmdc:mga0n895_713359_c1 3300050512 Unclassified 998
152 nmdc:mga0rr50_17028_c1 3300050513 Unclassified 4841
153 Ga0495619_0041757 3300053085 Bacteria 3001
154 Ga0501082_0284159 3300060353 Unclassified 1440
155 Ga0530510_1212677 3300061734 Bacteria 578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100142105 Ga0307408_1001421053 127
2 3300031901 Ga0307406_11037658 Ga0307406_110376582 127
3 3300005364 Ga0070673_100400071 Ga0070673_1004000712 141
4 3300005467 Ga0070706_100001689 Ga0070706_1000016896 141
5 3300005471 Ga0070698_100001513 Ga0070698_1000015131 141
6 3300005536 Ga0070697_100015284 Ga0070697_1000152848 141
7 3300013297 Ga0157378_11282018 Ga0157378_112820182 143
8 3300007076 Ga0075435_100038384 Ga0075435_1000383842 145
9 3300009147 Ga0114129_10007328 Ga0114129_1000732810 145
10 3300027617 Ga0210002_1006343 Ga0210002_10063432 145
11 3300050507 nmdc:mga05p37_347282_c1 nmdc:mga05p37_347282_c1_210_650 145
12 3300050512 nmdc:mga0n895_713359_c1 nmdc:mga0n895_713359_c1_19_459 145
13 3300050513 nmdc:mga0rr50_17028_c1 nmdc:mga0rr50_17028_c1_1807_2247 145
14 3300061734 Ga0530510_1212677 Ga0530510_1212677_109_549 145
15 3300046516 Ga0495628_0224243 Ga0495628_0224243_843_1283 146
16 3300041413 Ga0439465_0297243 Ga0439465_0297243_86_577 147
17 3300005355 Ga0070671_100247802 Ga0070671_1002478022 150
18 3300005445 Ga0070708_100204587 Ga0070708_1002045871 150
19 3300005457 Ga0070662_100000205 Ga0070662_10000020535 150
20 3300005467 Ga0070706_100414153 Ga0070706_1004141532 150
21 3300005468 Ga0070707_100004464 Ga0070707_10000446413 150
22 3300005471 Ga0070698_100125602 Ga0070698_1001256024 150
23 3300005536 Ga0070697_100414263 Ga0070697_1004142632 150
24 3300005544 Ga0070686_100219081 Ga0070686_1002190812 150
25 3300006871 Ga0075434_100060412 Ga0075434_1000604122 150
26 3300025910 Ga0207684_10004085 Ga0207684_100040852 150
27 3300025910 Ga0207684_10032216 Ga0207684_100322166 150
28 3300025910 Ga0207684_10038201 Ga0207684_100382012 150
29 3300025922 Ga0207646_10138487 Ga0207646_101384873 150
30 3300025933 Ga0207706_10000268 Ga0207706_1000026834 150
31 3300031824 Ga0307413_10007304 Ga0307413_100073042 150
32 3300031852 Ga0307410_10035046 Ga0307410_100350465 150
33 3300031903 Ga0307407_10161096 Ga0307407_101610961 150
34 3300032002 Ga0307416_102122009 Ga0307416_1021220092 150
35 3300032005 Ga0307411_10012438 Ga0307411_100124383 150
36 3300050512 nmdc:mga0n895_509685_c1 nmdc:mga0n895_509685_c1_406_879 150
37 3300005327 Ga0070658_10027693 Ga0070658_100276935 151
38 3300005334 Ga0068869_100048126 Ga0068869_1000481265 151
39 3300005336 Ga0070680_100426390 Ga0070680_1004263902 151
40 3300005471 Ga0070698_100046091 Ga0070698_1000460912 151
41 3300005518 Ga0070699_100792476 Ga0070699_1007924762 151
42 3300005543 Ga0070672_100160050 Ga0070672_1001600502 151
43 3300006237 Ga0097621_100321512 Ga0097621_1003215122 151
44 3300006358 Ga0068871_100257146 Ga0068871_1002571462 151
45 3300011119 Ga0105246_10053180 Ga0105246_100531804 151
46 3300013297 Ga0157378_10000013 Ga0157378_1000001325 151
47 3300013297 Ga0157378_10001593 Ga0157378_100015935 151
48 3300013308 Ga0157375_10000009 Ga0157375_10000009145 151
49 3300025909 Ga0207705_10092459 Ga0207705_100924593 151
50 3300025917 Ga0207660_10879505 Ga0207660_108795052 151
51 3300025940 Ga0207691_10089925 Ga0207691_100899252 151
52 3300025942 Ga0207689_10011362 Ga0207689_100113625 151
53 3300032002 Ga0307416_100371228 Ga0307416_1003712282 151
54 3300032005 Ga0307411_10171551 Ga0307411_101715513 151
55 3300035170 Ga0373943_0024259 Ga0373943_0024259_1855_2310 151
56 3300035170 Ga0373943_0451150 Ga0373943_0451150_52_507 151
57 3300035172 Ga0373955_0200916 Ga0373955_0200916_278_733 151
58 3300037068 Ga0373925_0135912 Ga0373925_0135912_65_520 151
59 3300041407 Ga0439447_116085 Ga0439447_116085_82_537 151
60 3300046475 Ga0495639_0005939 Ga0495639_0005939_36_491 151
61 3300046681 Ga0495647_0132449 Ga0495647_0132449_102_557 151
62 3300046794 Ga0495589_0297131 Ga0495589_0297131_50_505 151
63 3300047446 Ga0495679_016231 Ga0495679_016231_1094_1549 151
64 3300048909 Ga0496106_0139934 Ga0496106_0139934_246_701 151
65 3300050508 nmdc:mga09592_280375_c1 nmdc:mga09592_280375_c1_314_769 151
66 3300060353 Ga0501082_0284159 Ga0501082_0284159_534_989 151
67 3300005334 Ga0068869_100390067 Ga0068869_1003900672 152
68 3300005444 Ga0070694_100822924 Ga0070694_1008229242 152
69 3300005444 Ga0070694_100937214 Ga0070694_1009372142 152
70 3300005544 Ga0070686_100350190 Ga0070686_1003501903 152
71 3300006844 Ga0075428_100256663 Ga0075428_1002566631 152
72 3300025981 Ga0207640_10478862 Ga0207640_104788621 152
73 3300045051 Ga0451576_0587625 Ga0451576_0587625_217_675 152
74 3300005337 Ga0070682_100289085 Ga0070682_1002890851 153
75 3300005354 Ga0070675_100051130 Ga0070675_1000511305 153
76 3300005365 Ga0070688_100812981 Ga0070688_1008129812 153
77 3300005445 Ga0070708_100773087 Ga0070708_1007730872 153
78 3300005466 Ga0070685_10001133 Ga0070685_100011338 153
79 3300005518 Ga0070699_100126971 Ga0070699_1001269713 153
80 3300005844 Ga0068862_100028578 Ga0068862_1000285784 153
81 3300025918 Ga0207662_10211859 Ga0207662_102118592 153
82 3300025926 Ga0207659_10065699 Ga0207659_100656992 153
83 3300028380 Ga0268265_12149904 Ga0268265_121499041 153
84 3300031548 Ga0307408_100045861 Ga0307408_1000458612 153
85 3300031548 Ga0307408_100089659 Ga0307408_1000896593 153
86 3300031731 Ga0307405_10116365 Ga0307405_101163652 153
87 3300031824 Ga0307413_10023508 Ga0307413_100235083 153
88 3300031824 Ga0307413_10097660 Ga0307413_100976603 153
89 3300031852 Ga0307410_10002540 Ga0307410_100025406 153
90 3300031903 Ga0307407_10038798 Ga0307407_100387985 153
91 3300031903 Ga0307407_10284417 Ga0307407_102844172 153
92 3300031995 Ga0307409_100334086 Ga0307409_1003340862 153
93 3300031995 Ga0307409_100516536 Ga0307409_1005165362 153
94 3300032005 Ga0307411_10314739 Ga0307411_103147392 153
95 3300032005 Ga0307411_10720912 Ga0307411_107209122 153
96 3300032005 Ga0307411_11112943 Ga0307411_111129431 153
97 3300032126 Ga0307415_100204883 Ga0307415_1002048832 153
98 3300045976 Ga0466967_2342326 Ga0466967_2342326_47_508 153
99 3300005406 Ga0070703_10379528 Ga0070703_103795281 154
100 3300005438 Ga0070701_10013240 Ga0070701_100132404 154
101 3300005440 Ga0070705_100002442 Ga0070705_1000024426 154
102 3300005444 Ga0070694_100149019 Ga0070694_1001490192 154
103 3300005458 Ga0070681_10180114 Ga0070681_101801142 154
104 3300005467 Ga0070706_100013241 Ga0070706_1000132412 154
105 3300005468 Ga0070707_100005887 Ga0070707_1000058875 154
106 3300005471 Ga0070698_100000289 Ga0070698_10000028917 154
107 3300005471 Ga0070698_100034646 Ga0070698_1000346462 154
108 3300005518 Ga0070699_100001187 Ga0070699_1000011876 154
109 3300005536 Ga0070697_100023011 Ga0070697_1000230116 154
110 3300005546 Ga0070696_100273468 Ga0070696_1002734682 154
111 3300005546 Ga0070696_100317017 Ga0070696_1003170171 154
112 3300005549 Ga0070704_100000546 Ga0070704_1000005466 154
113 3300005617 Ga0068859_100011471 Ga0068859_1000114719 154
114 3300005844 Ga0068862_100051582 Ga0068862_1000515823 154
115 3300006846 Ga0075430_100056344 Ga0075430_1000563444 154
116 3300006847 Ga0075431_100376232 Ga0075431_1003762322 154
117 3300006847 Ga0075431_100714801 Ga0075431_1007148012 154
118 3300006880 Ga0075429_100256601 Ga0075429_1002566012 154
119 3300006880 Ga0075429_100386592 Ga0075429_1003865922 154
120 3300006931 Ga0097620_100011471 Ga0097620_1000114717 154
121 3300006931 Ga0097620_100419260 Ga0097620_1004192602 154
122 3300009148 Ga0105243_12191716 Ga0105243_121917161 154
123 3300009553 Ga0105249_10095942 Ga0105249_100959422 154
124 3300014326 Ga0157380_11044320 Ga0157380_110443202 154
125 3300014326 Ga0157380_11097975 Ga0157380_110979752 154
126 3300025885 Ga0207653_10184737 Ga0207653_101847371 154
127 3300025906 Ga0207699_10404393 Ga0207699_104043931 154
128 3300025922 Ga0207646_10016062 Ga0207646_100160625 154
129 3300028380 Ga0268265_10012952 Ga0268265_100129527 154
130 3300031852 Ga0307410_10020822 Ga0307410_100208223 154
131 3300031901 Ga0307406_10540780 Ga0307406_105407801 154
132 3300032002 Ga0307416_100214604 Ga0307416_1002146042 154
133 3300032005 Ga0307411_10060311 Ga0307411_100603112 154
134 3300032126 Ga0307415_102095692 Ga0307415_1020956921 154
135 3300037853 Ga0436364_0279310 Ga0436364_0279310_72_539 154
136 3300044693 Ga0466961_0000975 Ga0466961_0000975_3950_4441 154
137 3300044712 Ga0453684_0719689 Ga0453684_0719689_589_1068 154
138 3300046519 Ga0495632_0005112 Ga0495632_0005112_5035_5517 154
139 3300049669 Ga0501235_063346 Ga0501235_063346_150_614 154
140 3300050508 nmdc:mga09592_302283_c1 nmdc:mga09592_302283_c1_462_941 154
141 3300050510 nmdc:mga06r32_399039_c1 nmdc:mga06r32_399039_c1_430_906 154
142 3300050511 nmdc:mga08y16_869062_c1 nmdc:mga08y16_869062_c1_165_671 154
143 3300005545 Ga0070695_100000838 Ga0070695_10000083812 156
144 3300041408 Ga0439453_0173269 Ga0439453_0173269_27_506 156
145 3300044712 Ga0453684_0023275 Ga0453684_0023275_5012_5494 156
146 3300046472 Ga0495580_0000017 Ga0495580_0000017_35859_36335 156
147 3300005439 Ga0070711_100428872 Ga0070711_1004288722 158
148 3300005544 Ga0070686_100284905 Ga0070686_1002849051 158
149 3300047444 Ga0495675_0566919 Ga0495675_0566919_138_614 158
150 3300048088 Ga0495602_0179470 Ga0495602_0179470_697_1173 158
151 3300053085 Ga0495619_0041757 Ga0495619_0041757_1016_1492 158
152 3300005295 Ga0065707_10322556 Ga0065707_103225561 162
153 3300005444 Ga0070694_100072442 Ga0070694_1000724423 162
154 3300044673 Ga0453683_0280186 Ga0453683_0280186_482_994 162
155 3300044712 Ga0453684_0000927 Ga0453684_0000927_53373_53888 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14539

DUF4442

Domain of unknown function (DUF4442)

6

140

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sh8-assembly1.cif.gz_B 1.5 a crystal structure of a protein of unknown function pa5026 from pseudomonas aeruginosa, probable thioesterase 0.8517 11 157
1sh8-assembly1.cif.gz_B 1.5 a crystal structure of a protein of unknown function pa5026 from pseudomonas aeruginosa, probable thioesterase 0.8309 11 157
3r3c-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant h64a complexed with 4-hydroxyphenacyl coa 0.8158 23 160
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.8137 44 156
4qdb-assembly4.cif.gz_F crystal structure of mutant thioesterase pa1618 (q49a) from pseudomonas aeruginosa 0.8134 17 157
ID Description Score Start End Superfamily
1sh8B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8517 11 157 3.10.129.10
1sh8B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8309 11 157 3.10.129.10
3gekA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8178 44 156 3.10.129.10
1yocA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8084 17 157 3.10.129.10
af_Q09501_653_765_2.60.40.1260 Mainly Beta;Sandwich;Immunoglobulin-like;Lamin Tail domain 0.8003 135 151 2.60.40.1260
ID Description Score Start End GO Terms
AF-A0A7U6KST6-F1-model_v4 DUF4442 domain-containing protein 0.9866 71 157
AF-A3YCF1-F1-model_v4 Tetrameric acyl-CoA thioesterase 0.9839 49 159
AF-A0A6V7ET96-F1-model_v4 Tetrameric acyl-CoA thioesterase 0.9818 71 159
AF-A0A251WNI7-F1-model_v4 deleted 0.9817 37 158
AF-N8YQ84-F1-model_v4 DUF4442 domain-containing protein 0.9816 71 162

Feature Viewer

pLDDT pTM Quality
90.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map