F222938

General Info

Members Datasets Scaffolds Average Seq Length
155 95 155 203

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0173456|Ga0451576_0173456_1408_2127
Length 239
Sequence VANPTPSTTGGPAAALSLAQQLKAKFTDLVSEPEEFRGEFTVRISDAERIPEVCRFAKTELGFDYLLDITSVDNYGDDPRFTLVYHLYGYGHLQCLRLKTDVSEEKSEAPSVIGVWRTADWHEREIYDMMGVRFRGHPDLRRILMWEGYPYFPLRKDFPLSGKPSDLPEVAFTEPAPLAGGPFVTVAGGKDTISREPRVRIPETDSLELNARLERRQDIKNLHGEGHGPGPIEKKGHHG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
29 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
30 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
31 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
32 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
33 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
34 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
51 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
52 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
53 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
54 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
55 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
56 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
60 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10334071 3300005290 Bacteria 774
2 Ga0070658_10706863 3300005327 Bacteria 875
3 Ga0070666_10223244 3300005335 Bacteria 1329
4 Ga0070711_100002821 3300005439 Bacteria 9974
5 Ga0070681_10077775 3300005458 Bacteria 3274
6 Ga0070681_10609722 3300005458 Unclassified 1006
7 Ga0070686_100032475 3300005544 Bacteria 3201
8 Ga0070695_100657041 3300005545 Bacteria 828
9 Ga0068855_100135160 3300005563 Bacteria 2813
10 Ga0068856_100000058 3300005614 Bacteria 101767
11 Ga0068856_100163420 3300005614 Bacteria 2237
12 Ga0070712_100172982 3300006175 Bacteria 1677
13 Ga0075431_100146188 3300006847 Bacteria 2436
14 Ga0075433_10619775 3300006852 Bacteria 949
15 Ga0105240_10030133 3300009093 Bacteria 7057
16 Ga0105238_10159676 3300009551 Bacteria 2230
17 Ga0157374_10315404 3300013296 Bacteria 1549
18 Ga0157372_10422950 3300013307 Unclassified 1553
19 Ga0157372_10482910 3300013307 Bacteria 1444
20 Ga0157375_10000086 3300013308 Bacteria 93377
21 Ga0163163_10000126 3300014325 Bacteria 79511
22 Ga0157379_10381942 3300014968 Bacteria 1292
23 Ga0157376_11058782 3300014969 Unclassified 836
24 Ga0207705_10363833 3300025909 Bacteria 1116
25 Ga0207707_10027097 3300025912 Bacteria 5011
26 Ga0207695_10108235 3300025913 Bacteria 2764
27 Ga0207695_10273810 3300025913 Bacteria 1583
28 Ga0207663_10001010 3300025916 Bacteria 12879
29 Ga0207694_10053022 3300025924 Bacteria 3144
30 Ga0207667_10066422 3300025949 Bacteria 3759
31 Ga0207667_10118939 3300025949 Bacteria 2723
32 Ga0207702_10008996 3300026078 Bacteria 8411
33 Ga0207702_10359891 3300026078 Bacteria 1394
34 Ga0265337_1000140 3300028556 Bacteria 36107
35 Ga0265337_1001274 3300028556 Bacteria 12670
36 Ga0265337_1002167 3300028556 Bacteria 9209
37 Ga0265337_1006735 3300028556 Bacteria 4379
38 Ga0265326_10007590 3300028558 Bacteria 3316
39 Ga0265326_10018660 3300028558 Bacteria 1996
40 Ga0265326_10027591 3300028558 Bacteria 1619
41 Ga0265319_1006732 3300028563 Bacteria 5275
42 Ga0265319_1012564 3300028563 Bacteria 3419
43 Ga0265334_10137482 3300028573 Unclassified 867
44 Ga0265318_10094736 3300028577 Bacteria 1099
45 Ga0265323_10000237 3300028653 Bacteria 32647
46 Ga0265322_10080036 3300028654 Bacteria 927
47 Ga0265336_10000819 3300028666 Bacteria 16328
48 Ga0265336_10073067 3300028666 Bacteria 1025
49 Ga0265338_10000431 3300028800 Bacteria 75210
50 Ga0265338_10001555 3300028800 Bacteria 37061
51 Ga0265338_10004123 3300028800 Bacteria 19904
52 Ga0265338_10009242 3300028800 Bacteria 11797
53 Ga0265338_10010670 3300028800 Bacteria 10734
54 Ga0265338_10020690 3300028800 Bacteria 6905
55 Ga0265338_10082373 3300028800 Bacteria 2694
56 Ga0265338_10189186 3300028800 Bacteria 1562
57 Ga0265324_10001313 3300029957 Bacteria 14604
58 Ga0265324_10006339 3300029957 Bacteria 4950
59 Ga0265324_10013701 3300029957 Bacteria 3017
60 Ga0265324_10037356 3300029957 Bacteria 1687
61 Ga0265324_10086413 3300029957 Bacteria 1066
62 Ga0265324_10092022 3300029957 Bacteria 1031
63 Ga0265330_10038545 3300031235 Bacteria 2125
64 Ga0265328_10079961 3300031239 Bacteria 1205
65 Ga0265320_10008245 3300031240 Bacteria 6388
66 Ga0265320_10016271 3300031240 Bacteria 4173
67 Ga0265320_10057701 3300031240 Bacteria 1861
68 Ga0265320_10126294 3300031240 Bacteria 1163
69 Ga0265325_10120310 3300031241 Bacteria 1266
70 Ga0265329_10000517 3300031242 Bacteria 19923
71 Ga0265340_10000803 3300031247 Bacteria 17782
72 Ga0265340_10237392 3300031247 Bacteria 814
73 Ga0265331_10309028 3300031250 Bacteria 708
74 Ga0265327_10000752 3300031251 Bacteria 50420
75 Ga0265327_10003972 3300031251 Bacteria 13497
76 Ga0265327_10010095 3300031251 Bacteria 6695
77 Ga0265327_10084469 3300031251 Bacteria 1560
78 Ga0265316_10006885 3300031344 Bacteria 10789
79 Ga0265316_10085206 3300031344 Bacteria 2418
80 Ga0265316_10160919 3300031344 Bacteria 1678
81 Ga0265316_10272871 3300031344 Bacteria 1237
82 Ga0265316_10304947 3300031344 Bacteria 1159
83 Ga0265316_10352507 3300031344 Unclassified 1065
84 Ga0265313_10130456 3300031595 Bacteria 1089
85 Ga0265314_10000148 3300031711 Bacteria 105207
86 Ga0265314_10014321 3300031711 Bacteria 6356
87 Ga0265342_10065916 3300031712 Bacteria 2121
88 Ga0265342_10134658 3300031712 Bacteria 1382
89 Ga0373930_0012822 3300034816 Bacteria 1535
90 Ga0373950_0016076 3300034818 Bacteria 1276
91 Ga0373928_0000124 3300035084 Bacteria 14419
92 Ga0373944_0013346 3300035089 Bacteria 2277
93 Ga0373949_0044698 3300035090 Bacteria 1099
94 Ga0373951_0003865 3300035091 Bacteria 3600
95 Ga0373951_0023986 3300035091 Bacteria 1411
96 Ga0373932_0000001 3300035112 Bacteria 1459067
97 Ga0373945_0111169 3300035116 Bacteria 1081
98 Ga0373943_0245900 3300035170 Bacteria 1003
99 Ga0373946_0207856 3300035171 Bacteria 940
100 Ga0373962_0000018 3300035242 Bacteria 47177
101 Ga0373931_0000002 3300035691 Bacteria 599830
102 Ga0373937_0560017 3300036401 Bacteria 1086
103 Ga0373925_0000552 3300037068 Bacteria 36801
104 Ga0373925_0237449 3300037068 Bacteria 1459
105 Ga0373925_0611099 3300037068 Bacteria 898
106 Ga0436360_1146521 3300039438 Bacteria 2422
107 Ga0451577_0008522 3300042876 Bacteria 9973
108 Ga0451577_0215904 3300042876 Bacteria 1733
109 Ga0451577_0776197 3300042876 Bacteria 866
110 Ga0453684_0006217 3300044712 Bacteria 22893
111 Ga0453684_0009645 3300044712 Bacteria 16823
112 Ga0453684_0423713 3300044712 Bacteria 1486
113 Ga0453684_1474927 3300044712 Unclassified 703
114 Ga0451576_0029877 3300045051 Bacteria 5830
115 Ga0451576_0173456 3300045051 Bacteria 2251
116 Ga0495592_0000023 3300046454 Bacteria 137490
117 Ga0495592_0039846 3300046454 Bacteria 3528
118 Ga0495629_0138921 3300046459 Bacteria 1691
119 Ga0495639_0193539 3300046475 Bacteria 993
120 Ga0495662_0005799 3300046476 Bacteria 6180
121 Ga0495618_0002603 3300046514 Bacteria 11562
122 Ga0495628_0005164 3300046516 Bacteria 11475
123 Ga0495630_0000191 3300046517 Bacteria 47951
124 Ga0495630_0029891 3300046517 Bacteria 4052
125 Ga0495630_0374904 3300046517 Bacteria 1090
126 Ga0495666_0003696 3300046526 Bacteria 7731
127 Ga0495666_0248002 3300046526 Bacteria 811
128 Ga0495640_0006702 3300046533 Bacteria 9088
129 Ga0495640_0016747 3300046533 Bacteria 5479
130 Ga0495640_0449449 3300046533 Bacteria 787
131 Ga0495586_0000113 3300046535 Bacteria 48115
132 Ga0495586_0001744 3300046535 Bacteria 11869
133 Ga0495586_0104345 3300046535 Bacteria 1575
134 Ga0495645_0108402 3300046543 Bacteria 1967
135 Ga0495667_0387069 3300046559 Bacteria 881
136 Ga0495634_0209317 3300046642 Bacteria 1208
137 Ga0495657_0116506 3300046675 Bacteria 1687
138 Ga0495657_0121019 3300046675 Bacteria 1648
139 Ga0495599_0030915 3300046678 Bacteria 3361
140 Ga0495658_0022522 3300046683 Bacteria 3332
141 Ga0495658_0052350 3300046683 Bacteria 2315
142 Ga0495613_0291895 3300046689 Bacteria 1130
143 Ga0495624_0222112 3300046690 Bacteria 1145
144 Ga0495581_0037742 3300047315 Bacteria 2797
145 Ga0495581_0098366 3300047315 Bacteria 1699
146 Ga0495674_0003916 3300047319 Bacteria 14458
147 Ga0495674_0005490 3300047319 Bacteria 12182
148 Ga0501043_0203996 3300049579 Bacteria 1534
149 Ga0501080_0072681 3300049742 Bacteria 3200
150 Ga0501035_0577437 3300049822 Unclassified 918
151 nmdc:mga06r32_131287_c1 3300050510 Bacteria 2477
152 nmdc:mga08x19_486131_c1 3300050514 Bacteria 871
153 nmdc:mga0a205_639565_c1 3300050515 Bacteria 915
154 Ga0495601_0609499 3300053077 Bacteria 700
155 Ga0500650_0042235 3300053098 Bacteria 2107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10223244 Ga0070666_102232441 163
2 3300046475 Ga0495639_0193539 Ga0495639_0193539_69_671 163
3 3300046683 Ga0495658_0052350 Ga0495658_0052350_48_650 163
4 3300053077 Ga0495601_0609499 Ga0495601_0609499_48_647 163
5 3300005327 Ga0070658_10706863 Ga0070658_107068631 171
6 3300005458 Ga0070681_10609722 Ga0070681_106097221 171
7 3300005563 Ga0068855_100135160 Ga0068855_1001351604 173
8 3300013307 Ga0157372_10422950 Ga0157372_104229503 173
9 3300025949 Ga0207667_10118939 Ga0207667_101189393 173
10 3300014969 Ga0157376_11058782 Ga0157376_110587821 174
11 3300028800 Ga0265338_10010670 Ga0265338_1001067012 174
12 3300042876 Ga0451577_0008522 Ga0451577_0008522_7149_7787 176
13 3300044712 Ga0453684_0009645 Ga0453684_0009645_9689_10327 176
14 3300028800 Ga0265338_10020690 Ga0265338_1002069010 179
15 3300031344 Ga0265316_10352507 Ga0265316_103525072 179
16 3300005458 Ga0070681_10077775 Ga0070681_100777753 181
17 3300025912 Ga0207707_10027097 Ga0207707_100270972 181
18 3300039438 Ga0436360_1146521 Ga0436360_1146521_1213_1794 189
19 3300046517 Ga0495630_0374904 Ga0495630_0374904_233_907 189
20 3300005544 Ga0070686_100032475 Ga0070686_1000324755 191
21 3300005545 Ga0070695_100657041 Ga0070695_1006570411 191
22 3300005614 Ga0068856_100163420 Ga0068856_1001634203 191
23 3300006847 Ga0075431_100146188 Ga0075431_1001461882 191
24 3300006852 Ga0075433_10619775 Ga0075433_106197752 191
25 3300009551 Ga0105238_10159676 Ga0105238_101596763 191
26 3300025924 Ga0207694_10053022 Ga0207694_100530222 191
27 3300026078 Ga0207702_10359891 Ga0207702_103598912 191
28 3300028556 Ga0265337_1000140 Ga0265337_100014023 191
29 3300028556 Ga0265337_1001274 Ga0265337_10012743 191
30 3300028556 Ga0265337_1002167 Ga0265337_10021674 191
31 3300028556 Ga0265337_1006735 Ga0265337_10067357 191
32 3300028558 Ga0265326_10018660 Ga0265326_100186602 191
33 3300028558 Ga0265326_10027591 Ga0265326_100275912 191
34 3300028563 Ga0265319_1006732 Ga0265319_10067328 191
35 3300028563 Ga0265319_1012564 Ga0265319_10125642 191
36 3300028573 Ga0265334_10137482 Ga0265334_101374821 191
37 3300028577 Ga0265318_10094736 Ga0265318_100947362 191
38 3300028653 Ga0265323_10000237 Ga0265323_1000023733 191
39 3300028654 Ga0265322_10080036 Ga0265322_100800362 191
40 3300028666 Ga0265336_10000819 Ga0265336_100008197 191
41 3300028666 Ga0265336_10073067 Ga0265336_100730672 191
42 3300028800 Ga0265338_10000431 Ga0265338_100004319 191
43 3300028800 Ga0265338_10001555 Ga0265338_1000155515 191
44 3300028800 Ga0265338_10009242 Ga0265338_1000924210 191
45 3300028800 Ga0265338_10082373 Ga0265338_100823732 191
46 3300029957 Ga0265324_10001313 Ga0265324_100013132 191
47 3300029957 Ga0265324_10013701 Ga0265324_100137012 191
48 3300029957 Ga0265324_10086413 Ga0265324_100864132 191
49 3300029957 Ga0265324_10092022 Ga0265324_100920222 191
50 3300031235 Ga0265330_10038545 Ga0265330_100385452 191
51 3300031239 Ga0265328_10079961 Ga0265328_100799613 191
52 3300031240 Ga0265320_10008245 Ga0265320_100082452 191
53 3300031240 Ga0265320_10016271 Ga0265320_100162715 191
54 3300031240 Ga0265320_10057701 Ga0265320_100577012 191
55 3300031240 Ga0265320_10126294 Ga0265320_101262942 191
56 3300031241 Ga0265325_10120310 Ga0265325_101203102 191
57 3300031242 Ga0265329_10000517 Ga0265329_100005179 191
58 3300031247 Ga0265340_10000803 Ga0265340_1000080311 191
59 3300031247 Ga0265340_10237392 Ga0265340_102373921 191
60 3300031250 Ga0265331_10309028 Ga0265331_103090281 191
61 3300031251 Ga0265327_10000752 Ga0265327_1000075214 191
62 3300031251 Ga0265327_10003972 Ga0265327_100039725 191
63 3300031251 Ga0265327_10084469 Ga0265327_100844692 191
64 3300031344 Ga0265316_10006885 Ga0265316_1000688514 191
65 3300031344 Ga0265316_10160919 Ga0265316_101609192 191
66 3300031344 Ga0265316_10272871 Ga0265316_102728712 191
67 3300031344 Ga0265316_10304947 Ga0265316_103049471 191
68 3300031595 Ga0265313_10130456 Ga0265313_101304562 191
69 3300031711 Ga0265314_10000148 Ga0265314_1000014849 191
70 3300031711 Ga0265314_10014321 Ga0265314_100143211 191
71 3300031712 Ga0265342_10065916 Ga0265342_100659162 191
72 3300031712 Ga0265342_10134658 Ga0265342_101346583 191
73 3300035091 Ga0373951_0023986 Ga0373951_0023986_378_956 191
74 3300035171 Ga0373946_0207856 Ga0373946_0207856_190_813 191
75 3300042876 Ga0451577_0776197 Ga0451577_0776197_134_715 191
76 3300046454 Ga0495592_0000023 Ga0495592_0000023_55442_56020 191
77 3300046476 Ga0495662_0005799 Ga0495662_0005799_3194_3772 191
78 3300046514 Ga0495618_0002603 Ga0495618_0002603_7040_7618 191
79 3300046516 Ga0495628_0005164 Ga0495628_0005164_6658_7236 191
80 3300046517 Ga0495630_0029891 Ga0495630_0029891_705_1283 191
81 3300046526 Ga0495666_0248002 Ga0495666_0248002_31_609 191
82 3300046533 Ga0495640_0006702 Ga0495640_0006702_2537_3115 191
83 3300046535 Ga0495586_0001744 Ga0495586_0001744_3509_4087 191
84 3300046543 Ga0495645_0108402 Ga0495645_0108402_315_893 191
85 3300046642 Ga0495634_0209317 Ga0495634_0209317_454_1032 191
86 3300046675 Ga0495657_0121019 Ga0495657_0121019_800_1378 191
87 3300046678 Ga0495599_0030915 Ga0495599_0030915_136_714 191
88 3300046690 Ga0495624_0222112 Ga0495624_0222112_98_676 191
89 3300047315 Ga0495581_0037742 Ga0495581_0037742_619_1197 191
90 3300047319 Ga0495674_0003916 Ga0495674_0003916_7579_8157 191
91 3300050510 nmdc:mga06r32_131287_c1 nmdc:mga06r32_131287_c1_1769_2347 191
92 3300050514 nmdc:mga08x19_486131_c1 nmdc:mga08x19_486131_c1_14_592 191
93 3300050515 nmdc:mga0a205_639565_c1 nmdc:mga0a205_639565_c1_71_649 191
94 3300005290 Ga0065712_10334071 Ga0065712_103340711 192
95 3300005439 Ga0070711_100002821 Ga0070711_10000282111 192
96 3300005614 Ga0068856_100000058 Ga0068856_100000058102 192
97 3300006175 Ga0070712_100172982 Ga0070712_1001729823 192
98 3300009093 Ga0105240_10030133 Ga0105240_100301337 192
99 3300013296 Ga0157374_10315404 Ga0157374_103154043 192
100 3300013307 Ga0157372_10482910 Ga0157372_104829102 192
101 3300013308 Ga0157375_10000086 Ga0157375_1000008659 192
102 3300014325 Ga0163163_10000126 Ga0163163_1000012665 192
103 3300014968 Ga0157379_10381942 Ga0157379_103819422 192
104 3300025909 Ga0207705_10363833 Ga0207705_103638332 192
105 3300025913 Ga0207695_10108235 Ga0207695_101082354 192
106 3300025913 Ga0207695_10273810 Ga0207695_102738101 192
107 3300025916 Ga0207663_10001010 Ga0207663_1000101013 192
108 3300025949 Ga0207667_10066422 Ga0207667_100664222 192
109 3300026078 Ga0207702_10008996 Ga0207702_100089962 192
110 3300028558 Ga0265326_10007590 Ga0265326_100075904 192
111 3300028800 Ga0265338_10004123 Ga0265338_1000412310 192
112 3300028800 Ga0265338_10189186 Ga0265338_101891862 192
113 3300029957 Ga0265324_10006339 Ga0265324_100063395 192
114 3300029957 Ga0265324_10037356 Ga0265324_100373562 192
115 3300031251 Ga0265327_10010095 Ga0265327_100100954 192
116 3300031344 Ga0265316_10085206 Ga0265316_100852063 192
117 3300034816 Ga0373930_0012822 Ga0373930_0012822_614_1240 192
118 3300034818 Ga0373950_0016076 Ga0373950_0016076_144_770 192
119 3300035084 Ga0373928_0000124 Ga0373928_0000124_5068_5694 192
120 3300035089 Ga0373944_0013346 Ga0373944_0013346_292_876 192
121 3300035090 Ga0373949_0044698 Ga0373949_0044698_446_1072 192
122 3300035091 Ga0373951_0003865 Ga0373951_0003865_1131_1757 192
123 3300035112 Ga0373932_0000001 Ga0373932_0000001_1155939_1156565 192
124 3300035116 Ga0373945_0111169 Ga0373945_0111169_341_967 192
125 3300035170 Ga0373943_0245900 Ga0373943_0245900_92_718 192
126 3300035242 Ga0373962_0000018 Ga0373962_0000018_28203_28829 192
127 3300035691 Ga0373931_0000002 Ga0373931_0000002_338833_339459 192
128 3300036401 Ga0373937_0560017 Ga0373937_0560017_126_800 192
129 3300037068 Ga0373925_0000552 Ga0373925_0000552_22417_23043 192
130 3300037068 Ga0373925_0237449 Ga0373925_0237449_306_995 192
131 3300037068 Ga0373925_0611099 Ga0373925_0611099_71_655 192
132 3300042876 Ga0451577_0215904 Ga0451577_0215904_292_876 192
133 3300044712 Ga0453684_0006217 Ga0453684_0006217_1418_2002 192
134 3300044712 Ga0453684_0423713 Ga0453684_0423713_733_1356 192
135 3300044712 Ga0453684_1474927 Ga0453684_1474927_96_677 192
136 3300045051 Ga0451576_0029877 Ga0451576_0029877_5024_5608 192
137 3300045051 Ga0451576_0173456 Ga0451576_0173456_1408_2127 192
138 3300046454 Ga0495592_0039846 Ga0495592_0039846_1683_2282 192
139 3300046459 Ga0495629_0138921 Ga0495629_0138921_893_1582 192
140 3300046517 Ga0495630_0000191 Ga0495630_0000191_44054_44743 192
141 3300046526 Ga0495666_0003696 Ga0495666_0003696_5130_5819 192
142 3300046533 Ga0495640_0016747 Ga0495640_0016747_1049_1738 192
143 3300046533 Ga0495640_0449449 Ga0495640_0449449_72_689 192
144 3300046535 Ga0495586_0000113 Ga0495586_0000113_3708_4397 192
145 3300046535 Ga0495586_0104345 Ga0495586_0104345_50_667 192
146 3300046559 Ga0495667_0387069 Ga0495667_0387069_165_782 192
147 3300046675 Ga0495657_0116506 Ga0495657_0116506_619_1236 192
148 3300046683 Ga0495658_0022522 Ga0495658_0022522_812_1396 192
149 3300046689 Ga0495613_0291895 Ga0495613_0291895_207_896 192
150 3300047315 Ga0495581_0098366 Ga0495581_0098366_693_1382 192
151 3300047319 Ga0495674_0005490 Ga0495674_0005490_7763_8452 192
152 3300049579 Ga0501043_0203996 Ga0501043_0203996_46_657 192
153 3300049742 Ga0501080_0072681 Ga0501080_0072681_1844_2455 192
154 3300049822 Ga0501035_0577437 Ga0501035_0577437_184_795 192
155 3300053098 Ga0500650_0042235 Ga0500650_0042235_1414_2085 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

44

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.8893 3 125
5b3q-assembly1.cif.gz_A nqo5 of the trypsin-resistant fragment (1-134) in p63 form 0.8702 4 127
6u8y-assembly1.cif.gz_k structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.8626 3 124
8esw-assembly1.cif.gz_S3 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.8212 3 147
7z7t-assembly1.cif.gz_C complex i from e. coli, lmng-purified, under turnover at ph 6, open state 0.8209 5 146
ID Description Score Start End Superfamily
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9237 6 129 3.30.460.80
af_P9WJH3_48_196_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9231 5 127 3.30.460.80
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9089 3 129 3.30.460.80
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9062 4 129 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9028 6 129 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A7V0JHN1-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9524 4 130 GO:0008137
AF-A0A2N5JLM1-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9339 1 133 GO:0008137
AF-A0A3B9YS49-F1-model_v4 NADH-quinone oxidoreductase subunit C (EC 1.6.5.11) 0.9325 4 118 GO:0008137
AF-A0A7X5WD48-F1-model_v4 deleted 0.9258 4 125
AF-A0A7V5K7J2-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9233 4 136 GO:0008137

Feature Viewer

pLDDT pTM Quality
73.77 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map