F223391

General Info

Members Datasets Scaffolds Average Seq Length
155 102 310 204

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_114954_c1|nmdc:mga08x19_114954_c1_524_1168
Length 214
Sequence MFTGIVQEAGSVESVHKSSAGIRLAVRSPKAGAGLKIGDSVAVNGCCLTVVKLIPQLSRARAATGDRSRSERVVSFDLLHETWKRTNLQFAKAGALVNLERPLRADGRLDGHFVTGHIDGLGRIEKWERSGADHLLEVSAPSTIMRYIVSKGSIALDGISLTVAEVREERFVVWIIPHTYEVTAMRERKVGDAVNLETDILGKYVEKFVRPNNK

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
58 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
59 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
60 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
61 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
64 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_114954_c1 3300050514 Bacteria 1798
2 MRS1b_contig_4725145 2162886011 Bacteria 1273
3 rootH2_10016329 3300003320 Bacteria 7528
4 Ga0065712_10126025 3300005290 Bacteria 1607
5 Ga0070689_100000660 3300005340 Bacteria 20834
6 Ga0070691_10113560 3300005341 Unclassified 1357
7 Ga0070669_100376973 3300005353 Bacteria 1156
8 Ga0070688_100050125 3300005365 Bacteria 2600
9 Ga0070714_100141962 3300005435 Bacteria 2157
10 Ga0070681_10091534 3300005458 Bacteria 2991
11 Ga0070679_100932375 3300005530 Bacteria 812
12 Ga0068855_100011298 3300005563 Bacteria 10782
13 Ga0068855_100097115 3300005563 Bacteria 3394
14 Ga0068857_100062141 3300005577 Unclassified 3320
15 Ga0068857_100794735 3300005577 Bacteria 903
16 Ga0068856_100149971 3300005614 Bacteria 2340
17 Ga0068859_100713375 3300005617 Bacteria 1093
18 Ga0068864_100054951 3300005618 Bacteria 3437
19 Ga0068870_10038024 3300005840 Unclassified 2483
20 Ga0068863_100233329 3300005841 Bacteria 1775
21 Ga0070712_100704088 3300006175 Unclassified 861
22 Ga0075429_100469271 3300006880 Bacteria 1103
23 Ga0097620_100713448 3300006931 Bacteria 1093
24 Ga0105240_10036019 3300009093 Bacteria 6372
25 Ga0105240_10118505 3300009093 Bacteria 3190
26 Ga0105240_10192834 3300009093 Bacteria 2394
27 Ga0105240_11007147 3300009093 Bacteria 891
28 Ga0111539_10621352 3300009094 Unclassified 1258
29 Ga0105238_10001833 3300009551 Bacteria 21297
30 Ga0157370_10895614 3300013104 Bacteria 805
31 Ga0157374_10052598 3300013296 Bacteria 3794
32 Ga0157374_10554868 3300013296 Bacteria 1157
33 Ga0157374_10830614 3300013296 Bacteria 940
34 Ga0157374_10953707 3300013296 Unclassified 876
35 Ga0157378_10016886 3300013297 Bacteria 6397
36 Ga0157375_10258909 3300013308 Bacteria 1901
37 Ga0163163_10107725 3300014325 Bacteria 2813
38 Ga0157379_10097744 3300014968 Bacteria 2636
39 Ga0207643_10134322 3300025908 Bacteria 1474
40 Ga0207707_10071627 3300025912 Bacteria 3021
41 Ga0207695_10094506 3300025913 Bacteria 2996
42 Ga0207695_10439741 3300025913 Plasmid 1188
43 Ga0207694_10004426 3300025924 Bacteria 10983
44 Ga0207664_10122918 3300025929 Bacteria 2175
45 Ga0207670_10017045 3300025936 Bacteria 4383
46 Ga0207667_10110471 3300025949 Bacteria 2836
47 Ga0207702_10075250 3300026078 Bacteria 2916
48 Ga0207702_10446473 3300026078 Bacteria 1254
49 Ga0207702_10871349 3300026078 Bacteria 892
50 Ga0207641_10151635 3300026088 Bacteria 2100
51 Ga0207676_10096178 3300026095 Bacteria 2444
52 Ga0207676_10146740 3300026095 Bacteria 2027
53 Ga0207674_10020866 3300026116 Bacteria 7070
54 Ga0207674_10122321 3300026116 Unclassified 2568
55 Ga0265337_1001334 3300028556 Bacteria 12238
56 Ga0265337_1003892 3300028556 Bacteria 6325
57 Ga0265337_1024441 3300028556 Unclassified 1849
58 Ga0265323_10000524 3300028653 Bacteria 21302
59 Ga0265323_10048739 3300028653 Bacteria 1510
60 Ga0265323_10100672 3300028653 Bacteria 957
61 Ga0265323_10104291 3300028653 Bacteria 935
62 Ga0265322_10049448 3300028654 Bacteria 1194
63 Ga0265336_10000510 3300028666 Bacteria 22550
64 Ga0265336_10018600 3300028666 Bacteria 2250
65 Ga0265336_10087142 3300028666 Unclassified 931
66 Ga0265338_10000084 3300028800 Bacteria 175415
67 Ga0265338_10000626 3300028800 Bacteria 61483
68 Ga0265338_10000695 3300028800 Bacteria 57821
69 Ga0265338_10001714 3300028800 Bacteria 34782
70 Ga0265338_10003617 3300028800 Bacteria 21551
71 Ga0265338_10006737 3300028800 Bacteria 14511
72 Ga0265338_10009160 3300028800 Bacteria 11878
73 Ga0265338_10010525 3300028800 Bacteria 10818
74 Ga0265338_10041943 3300028800 Bacteria 4271
75 Ga0265338_10060282 3300028800 Bacteria 3336
76 Ga0265338_10091244 3300028800 Bacteria 2518
77 Ga0265338_10353813 3300028800 Bacteria 1055
78 Ga0265338_10736936 3300028800 Unclassified 678
79 Ga0265324_10000637 3300029957 Bacteria 23808
80 Ga0265324_10014131 3300029957 Unclassified 2962
81 Ga0265332_10052901 3300031238 Unclassified 1743
82 Ga0265320_10000145 3300031240 Bacteria 59716
83 Ga0265320_10000985 3300031240 Bacteria 21185
84 Ga0265320_10119976 3300031240 Bacteria 1200
85 Ga0265320_10181916 3300031240 Bacteria 942
86 Ga0265340_10000400 3300031247 Bacteria 23246
87 Ga0265331_10163812 3300031250 Bacteria 1007
88 Ga0265327_10000767 3300031251 Bacteria 49654
89 Ga0265327_10029234 3300031251 Bacteria 3138
90 Ga0265327_10057434 3300031251 Archaea 2002
91 Ga0265316_10023278 3300031344 Bacteria 5207
92 Ga0265316_10107487 3300031344 Bacteria 2115
93 Ga0265316_10191733 3300031344 Unclassified 1518
94 Ga0265316_10209002 3300031344 Bacteria 1444
95 Ga0265314_10119292 3300031711 Bacteria 1663
96 Ga0265342_10048552 3300031712 Unclassified 2544
97 Ga0265342_10155586 3300031712 Bacteria 1267
98 Ga0316576_10382995 3300031727 Unclassified 1044
99 Ga0316576_10438149 3300031727 Bacteria 966
100 Ga0316583_10006256 3300032133 Bacteria 4278
101 Ga0316583_10017092 3300032133 Bacteria 2609
102 Ga0316583_10052435 3300032133 Bacteria 1435
103 Ga0373928_0000600 3300035084 Bacteria 7085
104 Ga0373929_0000194 3300035085 Bacteria 10890
105 Ga0373944_0002247 3300035089 Bacteria 4912
106 Ga0373949_0040872 3300035090 Unclassified 1139
107 Ga0373932_0000004 3300035112 Bacteria 412176
108 Ga0373953_0050185 3300035117 Bacteria 1685
109 Ga0373956_0023006 3300035119 Bacteria 2671
110 Ga0373943_0115279 3300035170 Bacteria 1422
111 Ga0373955_0090853 3300035172 Bacteria 1740
112 Ga0373962_0000711 3300035242 Bacteria 7534
113 Ga0316574_0106879 3300035398 Unclassified 1793
114 Ga0373924_0034434 3300035410 Bacteria 2050
115 Ga0373931_0000036 3300035691 Bacteria 79351
116 Ga0373931_0180178 3300035691 Bacteria 1251
117 Ga0373927_0334686 3300035695 Bacteria 997
118 Ga0373947_0229596 3300035725 Unclassified 1222
119 Ga0373937_0054556 3300036401 Bacteria 3668
120 Ga0373937_0116435 3300036401 Bacteria 2489
121 Ga0373937_0613965 3300036401 Bacteria 1032
122 Ga0373925_0000171 3300037068 Bacteria 70398
123 Ga0451577_0003128 3300042876 Bacteria 18670
124 Ga0453684_0020291 3300044712 Bacteria 10035
125 Ga0453684_0453011 3300044712 Unclassified 1428
126 Ga0451576_0109484 3300045051 Bacteria 2875
127 Ga0495641_0216854 3300046461 Bacteria 858
128 Ga0495651_0163615 3300046462 Bacteria 1592
129 Ga0495639_0115328 3300046475 Unclassified 1278
130 Ga0495662_0200031 3300046476 Unclassified 985
131 Ga0495618_0183058 3300046514 Bacteria 1331
132 Ga0495630_0000090 3300046517 Bacteria 71226
133 Ga0495630_0460865 3300046517 Unclassified 974
134 Ga0495666_0001142 3300046526 Bacteria 12730
135 Ga0495586_0000059 3300046535 Bacteria 66207
136 Ga0495586_0041455 3300046535 Unclassified 2479
137 Ga0495645_0217411 3300046543 Bacteria 1287
138 Ga0495667_0438919 3300046559 Bacteria 821
139 Ga0495634_0014979 3300046642 Bacteria 5576
140 Ga0495599_0040520 3300046678 Bacteria 2925
141 Ga0495613_0021205 3300046689 Bacteria 4846
142 Ga0495613_0251166 3300046689 Bacteria 1234
143 Ga0495674_0000212 3300047319 Bacteria 48127
144 Ga0495676_0033384 3300047321 Bacteria 4335
145 Ga0495675_0077513 3300047444 Bacteria 2094
146 Ga0495614_0127182 3300048089 Unclassified 1126
147 Ga0496115_0165583 3300048918 Unclassified 1828
148 Ga0501047_0341039 3300049581 Bacteria 1336
149 nmdc:mga09592_218125_c1 3300050508 Unclassified 1653
150 nmdc:mga08y16_437050_c1 3300050511 Unclassified 1336
151 nmdc:mga08y16_452998_c1 3300050511 Unclassified 1308
152 nmdc:mga0rr50_965216_c1 3300050513 Unclassified 726
153 nmdc:mga0a205_683950_c1 3300050515 Unclassified 876
154 Ga0500651_0224219 3300053093 Unclassified 1101
155 643602924 643348564 Bacteria 8839022
156 nmdc:mga08x19_114954_c1
157 MRS1b_contig_4725145
158 rootH2_10016329
159 Ga0065712_10126025
160 Ga0070689_100000660
161 Ga0070691_10113560
162 Ga0070669_100376973
163 Ga0070688_100050125
164 Ga0070714_100141962
165 Ga0070681_10091534
166 Ga0070679_100932375
167 Ga0068855_100011298
168 Ga0068855_100097115
169 Ga0068857_100062141
170 Ga0068857_100794735
171 Ga0068856_100149971
172 Ga0068859_100713375
173 Ga0068864_100054951
174 Ga0068870_10038024
175 Ga0068863_100233329
176 Ga0070712_100704088
177 Ga0075429_100469271
178 Ga0097620_100713448
179 Ga0105240_10036019
180 Ga0105240_10118505
181 Ga0105240_10192834
182 Ga0105240_11007147
183 Ga0111539_10621352
184 Ga0105238_10001833
185 Ga0157370_10895614
186 Ga0157374_10052598
187 Ga0157374_10554868
188 Ga0157374_10830614
189 Ga0157374_10953707
190 Ga0157378_10016886
191 Ga0157375_10258909
192 Ga0163163_10107725
193 Ga0157379_10097744
194 Ga0207643_10134322
195 Ga0207707_10071627
196 Ga0207695_10094506
197 Ga0207695_10439741
198 Ga0207694_10004426
199 Ga0207664_10122918
200 Ga0207670_10017045
201 Ga0207667_10110471
202 Ga0207702_10075250
203 Ga0207702_10446473
204 Ga0207702_10871349
205 Ga0207641_10151635
206 Ga0207676_10096178
207 Ga0207676_10146740
208 Ga0207674_10020866
209 Ga0207674_10122321
210 Ga0265337_1001334
211 Ga0265337_1003892
212 Ga0265337_1024441
213 Ga0265323_10000524
214 Ga0265323_10048739
215 Ga0265323_10100672
216 Ga0265323_10104291
217 Ga0265322_10049448
218 Ga0265336_10000510
219 Ga0265336_10018600
220 Ga0265336_10087142
221 Ga0265338_10000084
222 Ga0265338_10000626
223 Ga0265338_10000695
224 Ga0265338_10001714
225 Ga0265338_10003617
226 Ga0265338_10006737
227 Ga0265338_10009160
228 Ga0265338_10010525
229 Ga0265338_10041943
230 Ga0265338_10060282
231 Ga0265338_10091244
232 Ga0265338_10353813
233 Ga0265338_10736936
234 Ga0265324_10000637
235 Ga0265324_10014131
236 Ga0265332_10052901
237 Ga0265320_10000145
238 Ga0265320_10000985
239 Ga0265320_10119976
240 Ga0265320_10181916
241 Ga0265340_10000400
242 Ga0265331_10163812
243 Ga0265327_10000767
244 Ga0265327_10029234
245 Ga0265327_10057434
246 Ga0265316_10023278
247 Ga0265316_10107487
248 Ga0265316_10191733
249 Ga0265316_10209002
250 Ga0265314_10119292
251 Ga0265342_10048552
252 Ga0265342_10155586
253 Ga0316576_10382995
254 Ga0316576_10438149
255 Ga0316583_10006256
256 Ga0316583_10017092
257 Ga0316583_10052435
258 Ga0373928_0000600
259 Ga0373929_0000194
260 Ga0373944_0002247
261 Ga0373949_0040872
262 Ga0373932_0000004
263 Ga0373953_0050185
264 Ga0373956_0023006
265 Ga0373943_0115279
266 Ga0373955_0090853
267 Ga0373962_0000711
268 Ga0316574_0106879
269 Ga0373924_0034434
270 Ga0373931_0000036
271 Ga0373931_0180178
272 Ga0373927_0334686
273 Ga0373947_0229596
274 Ga0373937_0054556
275 Ga0373937_0116435
276 Ga0373937_0613965
277 Ga0373925_0000171
278 Ga0451577_0003128
279 Ga0453684_0020291
280 Ga0453684_0453011
281 Ga0451576_0109484
282 Ga0495641_0216854
283 Ga0495651_0163615
284 Ga0495639_0115328
285 Ga0495662_0200031
286 Ga0495618_0183058
287 Ga0495630_0000090
288 Ga0495630_0460865
289 Ga0495666_0001142
290 Ga0495586_0000059
291 Ga0495586_0041455
292 Ga0495645_0217411
293 Ga0495667_0438919
294 Ga0495634_0014979
295 Ga0495599_0040520
296 Ga0495613_0021205
297 Ga0495613_0251166
298 Ga0495674_0000212
299 Ga0495676_0033384
300 Ga0495675_0077513
301 Ga0495614_0127182
302 Ga0496115_0165583
303 Ga0501047_0341039
304 nmdc:mga09592_218125_c1
305 nmdc:mga08y16_437050_c1
306 nmdc:mga08y16_452998_c1
307 nmdc:mga0rr50_965216_c1
308 nmdc:mga0a205_683950_c1
309 Ga0500651_0224219
310 643602924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

115

199

0.99

PF00677

Lum_binding

Lumazine binding domain

3

102

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9321 1 90
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.9218 1 187
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9218 1 90
3a3b-assembly1.cif.gz_B crystal structure of lump complexed with flavin mononucleotide 0.9188 1 187
3a3g-assembly2.cif.gz_B crystal structure of lump complexed with 6,7-dimethyl-8-(1'-d-ribityl) lumazine 0.9149 1 187
ID Description Score Start End Superfamily
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9705 1 91 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9661 105 195 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9599 1 91 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9458 105 195 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9444 1 91 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7C5D2L2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9383 1 162 GO:0004746
GO:0009231
AF-A0A7C5D2L2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9327 1 162 GO:0004746
GO:0009231
AF-A0A0F0CST5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9325 1 194 GO:0004746
GO:0009231
AF-A0A1S9CM18-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9278 1 196 GO:0004746
GO:0009231
AF-A0A3N5B421-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.927 1 198 GO:0004746
GO:0009231

Map