F223754

General Info

Members Datasets Scaffolds Average Seq Length
156 84 312 189

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10000828|rootH1_100008283
Length 212
Sequence MRVKYSFAGRTWQIHVARPHHRPMALRIVHYNDPVLRKKGEPVKVFDAALALLSDQMLATMNTAAGIGLAAQQIGRALQFCVVDLRQTDRDFAWELDGATPPLELFMPLSLANPVVKVLPSEKTVYEEGCLSFPHIRGDVIRPDAIEVTYQDIQGASHTLRCDGLLARCIQHEVDHLNGTLFIDRMEKKVRGGIEKDIKELAKKTREESEGV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
35 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
79 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000828 3300003323 Bacteria 5619
2 rootH2_10001325 3300003320 Bacteria 14623
3 rootL2_10051374 3300003322 Bacteria 5465
4 rootH1_10170609 3300003323 Bacteria 2398
5 rootH1_10180704 3300003323 Bacteria 2085
6 Ga0070683_100001399 3300005329 Bacteria 18515
7 Ga0068869_100000005 3300005334 Bacteria 103764
8 Ga0068868_100015534 3300005338 Bacteria 5634
9 Ga0070713_100002257 3300005436 Bacteria 12512
10 Ga0068867_100000853 3300005459 Bacteria 20577
11 Ga0070679_100015546 3300005530 Bacteria 7313
12 Ga0068857_100563247 3300005577 Unclassified 1074
13 Ga0068856_100019312 3300005614 Bacteria 6616
14 Ga0068856_100024770 3300005614 Bacteria 5845
15 Ga0070717_10060285 3300006028 Bacteria 3142
16 Ga0097621_100003103 3300006237 Bacteria 11393
17 Ga0068871_100006845 3300006358 Bacteria 8114
18 Ga0157369_10164391 3300013105 Bacteria 2341
19 Ga0163163_10090355 3300014325 Unclassified 3075
20 Ga0157379_10668594 3300014968 Bacteria 973
21 Ga0157376_10062719 3300014969 Bacteria 3128
22 Ga0207693_10955059 3300025915 Unclassified 656
23 Ga0207652_10010882 3300025921 Bacteria 7332
24 Ga0207700_10021321 3300025928 Bacteria 4422
25 Ga0207689_10000629 3300025942 Bacteria 33613
26 Ga0207661_10055413 3300025944 Bacteria 3180
27 Ga0207677_10016305 3300026023 Bacteria 4395
28 Ga0207702_10001374 3300026078 Bacteria 24256
29 Ga0207702_10249859 3300026078 Unclassified 1665
30 Ga0207648_10005750 3300026089 Bacteria 12430
31 Ga0207674_10585040 3300026116 Unclassified 1078
32 Ga0207683_10377997 3300026121 Bacteria 1302
33 Ga0265337_1002878 3300028556 Bacteria 7676
34 Ga0265337_1005267 3300028556 Bacteria 5166
35 Ga0265337_1007330 3300028556 Bacteria 4135
36 Ga0265337_1023436 3300028556 Bacteria 1899
37 Ga0265337_1031448 3300028556 Bacteria 1577
38 Ga0265326_10036180 3300028558 Bacteria 1404
39 Ga0265319_1000755 3300028563 Bacteria 21072
40 Ga0265319_1002076 3300028563 Bacteria 11238
41 Ga0265319_1002267 3300028563 Bacteria 10638
42 Ga0265319_1002919 3300028563 Bacteria 9118
43 Ga0265319_1009847 3300028563 Bacteria 4033
44 Ga0265319_1030100 3300028563 Bacteria 1901
45 Ga0265334_10148216 3300028573 Bacteria 828
46 Ga0265318_10000406 3300028577 Bacteria 33364
47 Ga0265318_10001890 3300028577 Bacteria 11742
48 Ga0265318_10002888 3300028577 Bacteria 8946
49 Ga0265318_10009255 3300028577 Bacteria 4344
50 Ga0265318_10024031 3300028577 Unclassified 2423
51 Ga0265318_10081147 3300028577 Bacteria 1198
52 Ga0265323_10000063 3300028653 Bacteria 58892
53 Ga0265323_10026558 3300028653 Bacteria 2182
54 Ga0265322_10000081 3300028654 Bacteria 45549
55 Ga0265322_10005097 3300028654 Bacteria 3887
56 Ga0265322_10021346 3300028654 Bacteria 1855
57 Ga0265322_10057795 3300028654 Bacteria 1100
58 Ga0265338_10000407 3300028800 Bacteria 77238
59 Ga0265338_10010492 3300028800 Bacteria 10849
60 Ga0265338_10087397 3300028800 Unclassified 2590
61 Ga0265338_10389917 3300028800 Bacteria 995
62 Ga0265324_10000052 3300029957 Bacteria 97159
63 Ga0265324_10000587 3300029957 Bacteria 24898
64 Ga0265324_10023952 3300029957 Unclassified 2172
65 Ga0265324_10029247 3300029957 Bacteria 1938
66 Ga0265332_10008591 3300031238 Bacteria 4588
67 Ga0265332_10116591 3300031238 Bacteria 1123
68 Ga0265332_10135818 3300031238 Bacteria 1031
69 Ga0265328_10027001 3300031239 Bacteria 2155
70 Ga0265328_10027735 3300031239 Unclassified 2121
71 Ga0265320_10000771 3300031240 Bacteria 24529
72 Ga0265320_10001682 3300031240 Bacteria 15726
73 Ga0265320_10004266 3300031240 Bacteria 9395
74 Ga0265320_10006353 3300031240 Bacteria 7452
75 Ga0265320_10008465 3300031240 Bacteria 6296
76 Ga0265320_10014825 3300031240 Bacteria 4421
77 Ga0265320_10163395 3300031240 Bacteria 1002
78 Ga0265320_10223508 3300031240 Bacteria 838
79 Ga0265325_10025043 3300031241 Bacteria 3241
80 Ga0265325_10032904 3300031241 Bacteria 2766
81 Ga0265340_10018927 3300031247 Bacteria 3548
82 Ga0265340_10147590 3300031247 Unclassified 1073
83 Ga0265339_10322838 3300031249 Bacteria 732
84 Ga0265331_10002435 3300031250 Bacteria 12607
85 Ga0265331_10006999 3300031250 Bacteria 6584
86 Ga0265327_10000092 3300031251 Bacteria 195619
87 Ga0265327_10068791 3300031251 Bacteria 1779
88 Ga0265327_10074002 3300031251 Bacteria 1698
89 Ga0265316_10000676 3300031344 Bacteria 37951
90 Ga0265316_10008848 3300031344 Bacteria 9298
91 Ga0265316_10012377 3300031344 Bacteria 7655
92 Ga0265316_10016063 3300031344 Bacteria 6513
93 Ga0265316_10033590 3300031344 Bacteria 4176
94 Ga0265316_10040391 3300031344 Bacteria 3740
95 Ga0265316_10114409 3300031344 Bacteria 2041
96 Ga0307408_100000007 3300031548 Bacteria 463086
97 Ga0265313_10000706 3300031595 Bacteria 34509
98 Ga0265313_10001138 3300031595 Bacteria 25416
99 Ga0265313_10002081 3300031595 Bacteria 17894
100 Ga0265313_10003407 3300031595 Bacteria 12886
101 Ga0265314_10007112 3300031711 Bacteria 9757
102 Ga0265314_10062984 3300031711 Bacteria 2518
103 Ga0265314_10281412 3300031711 Bacteria 941
104 Ga0265342_10004395 3300031712 Bacteria 11124
105 Ga0265342_10006621 3300031712 Bacteria 8601
106 Ga0265342_10033587 3300031712 Bacteria 3153
107 Ga0265342_10046055 3300031712 Bacteria 2622
108 Ga0265342_10119790 3300031712 Bacteria 1483
109 Ga0265342_10193841 3300031712 Bacteria 1108
110 Ga0307405_10124063 3300031731 Bacteria 1773
111 Ga0307413_10511909 3300031824 Bacteria 966
112 Ga0307410_10001288 3300031852 Bacteria 11170
113 Ga0307407_10018494 3300031903 Bacteria 3525
114 Ga0307412_10021428 3300031911 Bacteria 3948
115 Ga0307409_100000061 3300031995 Bacteria 39679
116 Ga0307416_100000073 3300032002 Bacteria 80676
117 Ga0373939_0102827 3300035114 Bacteria 983
118 Ga0373937_0233115 3300036401 Bacteria 1734
119 Ga0395905_0000016 3300037471 Bacteria 382308
120 Ga0439431_0034531 3300041997 Bacteria 1268
121 Ga0451577_0000327 3300042876 Bacteria 88625
122 Ga0451577_0001860 3300042876 Bacteria 26905
123 Ga0466972_0104743 3300044658 Bacteria 1338
124 Ga0453683_0002931 3300044673 Bacteria 12865
125 Ga0453684_0007932 3300044712 Bacteria 19257
126 Ga0453684_0077672 3300044712 Bacteria 4159
127 Ga0453684_0154084 3300044712 Bacteria 2727
128 Ga0453684_0159403 3300044712 Bacteria 2671
129 Ga0453684_0295313 3300044712 Bacteria 1843
130 Ga0453684_0647096 3300044712 Bacteria 1154
131 Ga0466970_0005831 3300044765 Bacteria 6130
132 Ga0466959_0126563 3300045049 Bacteria 1813
133 Ga0451576_0000146 3300045051 Bacteria 179707
134 Ga0451576_0001618 3300045051 Bacteria 37793
135 Ga0451576_0078756 3300045051 Bacteria 3429
136 Ga0451576_0479748 3300045051 Bacteria 1306
137 Ga0451576_0496174 3300045051 Unclassified 1282
138 Ga0451576_1050748 3300045051 Bacteria 853
139 Ga0466967_0251010 3300045976 Bacteria 1690
140 Ga0495631_0065374 3300046518 Bacteria 1574
141 Ga0495637_0000001 3300046520 Bacteria 820224
142 Ga0495597_0115514 3300046542 Bacteria 1122
143 Ga0495661_0000002 3300046665 Bacteria 823350
144 Ga0501034_0123191 3300049571 Bacteria 2578
145 Ga0501038_0478252 3300049574 Bacteria 955
146 Ga0501046_0000009 3300049580 Bacteria 335813
147 Ga0501047_0873815 3300049581 Bacteria 713
148 Ga0501227_014133 3300049665 Bacteria 1768
149 Ga0501243_000474 3300049675 Bacteria 5343
150 Ga0501083_0002600 3300049744 Bacteria 12431
151 Ga0501269_021866 3300049766 Bacteria 800
152 Ga0501044_0002898 3300049823 Bacteria 19536
153 Ga0501044_0402624 3300049823 Bacteria 1281
154 Ga0587109_041652 3300059624 Unclassified 913
155 Ga0501082_0050981 3300060353 Bacteria 3568
156 Ga0501082_0410447 3300060353 Bacteria 1182
157 rootH1_10000828
158 rootH2_10001325
159 rootL2_10051374
160 rootH1_10170609
161 rootH1_10180704
162 Ga0070683_100001399
163 Ga0068869_100000005
164 Ga0068868_100015534
165 Ga0070713_100002257
166 Ga0068867_100000853
167 Ga0070679_100015546
168 Ga0068857_100563247
169 Ga0068856_100019312
170 Ga0068856_100024770
171 Ga0070717_10060285
172 Ga0097621_100003103
173 Ga0068871_100006845
174 Ga0157369_10164391
175 Ga0163163_10090355
176 Ga0157379_10668594
177 Ga0157376_10062719
178 Ga0207693_10955059
179 Ga0207652_10010882
180 Ga0207700_10021321
181 Ga0207689_10000629
182 Ga0207661_10055413
183 Ga0207677_10016305
184 Ga0207702_10001374
185 Ga0207702_10249859
186 Ga0207648_10005750
187 Ga0207674_10585040
188 Ga0207683_10377997
189 Ga0265337_1002878
190 Ga0265337_1005267
191 Ga0265337_1007330
192 Ga0265337_1023436
193 Ga0265337_1031448
194 Ga0265326_10036180
195 Ga0265319_1000755
196 Ga0265319_1002076
197 Ga0265319_1002267
198 Ga0265319_1002919
199 Ga0265319_1009847
200 Ga0265319_1030100
201 Ga0265334_10148216
202 Ga0265318_10000406
203 Ga0265318_10001890
204 Ga0265318_10002888
205 Ga0265318_10009255
206 Ga0265318_10024031
207 Ga0265318_10081147
208 Ga0265323_10000063
209 Ga0265323_10026558
210 Ga0265322_10000081
211 Ga0265322_10005097
212 Ga0265322_10021346
213 Ga0265322_10057795
214 Ga0265338_10000407
215 Ga0265338_10010492
216 Ga0265338_10087397
217 Ga0265338_10389917
218 Ga0265324_10000052
219 Ga0265324_10000587
220 Ga0265324_10023952
221 Ga0265324_10029247
222 Ga0265332_10008591
223 Ga0265332_10116591
224 Ga0265332_10135818
225 Ga0265328_10027001
226 Ga0265328_10027735
227 Ga0265320_10000771
228 Ga0265320_10001682
229 Ga0265320_10004266
230 Ga0265320_10006353
231 Ga0265320_10008465
232 Ga0265320_10014825
233 Ga0265320_10163395
234 Ga0265320_10223508
235 Ga0265325_10025043
236 Ga0265325_10032904
237 Ga0265340_10018927
238 Ga0265340_10147590
239 Ga0265339_10322838
240 Ga0265331_10002435
241 Ga0265331_10006999
242 Ga0265327_10000092
243 Ga0265327_10068791
244 Ga0265327_10074002
245 Ga0265316_10000676
246 Ga0265316_10008848
247 Ga0265316_10012377
248 Ga0265316_10016063
249 Ga0265316_10033590
250 Ga0265316_10040391
251 Ga0265316_10114409
252 Ga0307408_100000007
253 Ga0265313_10000706
254 Ga0265313_10001138
255 Ga0265313_10002081
256 Ga0265313_10003407
257 Ga0265314_10007112
258 Ga0265314_10062984
259 Ga0265314_10281412
260 Ga0265342_10004395
261 Ga0265342_10006621
262 Ga0265342_10033587
263 Ga0265342_10046055
264 Ga0265342_10119790
265 Ga0265342_10193841
266 Ga0307405_10124063
267 Ga0307413_10511909
268 Ga0307410_10001288
269 Ga0307407_10018494
270 Ga0307412_10021428
271 Ga0307409_100000061
272 Ga0307416_100000073
273 Ga0373939_0102827
274 Ga0373937_0233115
275 Ga0395905_0000016
276 Ga0439431_0034531
277 Ga0451577_0000327
278 Ga0451577_0001860
279 Ga0466972_0104743
280 Ga0453683_0002931
281 Ga0453684_0007932
282 Ga0453684_0077672
283 Ga0453684_0154084
284 Ga0453684_0159403
285 Ga0453684_0295313
286 Ga0453684_0647096
287 Ga0466970_0005831
288 Ga0466959_0126563
289 Ga0451576_0000146
290 Ga0451576_0001618
291 Ga0451576_0078756
292 Ga0451576_0479748
293 Ga0451576_0496174
294 Ga0451576_1050748
295 Ga0466967_0251010
296 Ga0495631_0065374
297 Ga0495637_0000001
298 Ga0495597_0115514
299 Ga0495661_0000002
300 Ga0501034_0123191
301 Ga0501038_0478252
302 Ga0501046_0000009
303 Ga0501047_0873815
304 Ga0501227_014133
305 Ga0501243_000474
306 Ga0501083_0002600
307 Ga0501269_021866
308 Ga0501044_0002898
309 Ga0501044_0402624
310 Ga0587109_041652
311 Ga0501082_0050981
312 Ga0501082_0410447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

25

192

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9117 4 172
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9002 4 172
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.8938 1 156
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.8864 1 155
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.8838 3 175
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8929 1 156 3.90.45.10
af_K7VJY5_57_249_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8879 2 178 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8864 1 155 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8785 1 157 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8755 4 150 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A2A2QR34-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9629 1 176 GO:0006412
GO:0042586
GO:0046872
AF-A0A848WWV6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9521 1 174 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A0R2XAF4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.95 3 174 GO:0006412
GO:0042586
GO:0046872
AF-A0A1G3Z7L1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9483 5 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A840V5S9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9472 1 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map