F225028

General Info

Members Datasets Scaffolds Average Seq Length
156 109 151 969

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10017462|Ga0207690_100174623
Length 986
Sequence MTEQSPSDKLNRASNAILEATSFLNGTNAAFVEQLYARYLADPGSVEQGWHDYFAQLGEKGLTPSQLGRGPAWKRDIQTDFADGELIAALTGQQPPAADKVVKGKKAXXXGPAASPDAAKYSIHAVQLIRAYRMIGHLEADLDPLGIMPRTPQPSLDPAHYGFEGATLDQPVYVDGILGLSTATPRQLVDKLRGIYCGRIGYEFMHINDAEQKQWLQRRIEGEAGQIGFTPEGKKAILNKLIEAEGFEKFAANRFVGTKRFGLDGAESTIPALEQIIKRGGQLGVSEIVLGMAHRGRLNVLVNVMGKPYRQLFHEFQGGAANPSSVEGSGDVKYHLGASSDREFDGHKVHLSLTANPSHLEIVDPVVLGKARAKQWQLHDIDARTSVLPLLIHGDAAFAGQGVVAECFAMSGIKGFRTGGTIHFVINNQIGFTTAPVFSRSSPYCTDIALMVQAPILHVNGDDPEAVVHAARVAIEFRQQFNKDVVLDMICYRRFGHNETDEPSFTQPQMYRVIRSHATTLQLYTKKLIDEGTLTAVDAAAMQSDFNTRLDEEFNASKSHLPNRADWLDGKWQGMEAAPKAGDRRGDTGVPEETLRSVGKALTTTPENFNLHKTIARQLEAKAKMFETGEGFDWATCEALAFGTLLNEGYYIRLSGQDSSRGTFSQRHAALVDQESEERYYPLQHISGEQGCFEVVDSLLSEEAVLGFEYGYSMAEPRALVLWEAQFGDFANGAQVVVDQFISSGETKWLRMSGLTLLLPHGYEGQGPEHSSARLERYLQLCAQDNMQVCVPTTPANYFHMLRRQMQRPFRKPLIVLTPKSLLRHKRCVSFLSDMLPSNSFHRVLRDQAEVVPGATTIQLVSDAKIKRVVLCTGKVYFDLLEEREKRGENRIQIIRIEQLYPFPENVLAQELNRFPTADIVWCQEEPQNQGAWTFIKPRIEATITQLGGKATPRYAGRPESASTAAGLLKQHQAELAAFLNDALTL

Samples

Sample ID Description Type Environment
1 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
2 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
3 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
104 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
105 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
109 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0.64
Rhizoplane 0
Rhizosphere 84.62
Stem 0
Stem Tuber 0.64
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000047 3300003214 Bacteria 254601
2 JGI25165J46597_1000066 3300003214 Bacteria 199459
3 JGI25153J46596_10000498 3300003215 Bacteria 24974
4 Ga0070666_10000186 3300005335 Bacteria 42661
5 Ga0070680_100000132 3300005336 Bacteria 44873
6 Ga0070680_100028166 3300005336 Bacteria 4505
7 Ga0070661_100004139 3300005344 Bacteria 10002
8 Ga0070709_10008977 3300005434 Bacteria 5506
9 Ga0070713_100000002 3300005436 Bacteria 245989
10 Ga0070679_100041422 3300005530 Bacteria 4584
11 Ga0068853_100003994 3300005539 Bacteria 11341
12 Ga0070665_100001530 3300005548 Bacteria 26749
13 Ga0068855_100000034 3300005563 Bacteria 166436
14 Ga0068855_100037139 3300005563 Bacteria 5795
15 Ga0068857_100000488 3300005577 Bacteria 28351
16 Ga0068856_100000312 3300005614 Bacteria 53339
17 Ga0068856_100013259 3300005614 Bacteria 7982
18 Ga0068858_100002481 3300005842 Bacteria 18623
19 Ga0070712_100000272 3300006175 Bacteria 29104
20 Ga0075436_100000098 3300006914 Bacteria 51153
21 Ga0105240_10008350 3300009093 Bacteria 14823
22 Ga0105240_10015089 3300009093 Bacteria 10516
23 Ga0105248_10000001 3300009177 Bacteria 1881304
24 Ga0105237_10001328 3300009545 Bacteria 32811
25 Ga0105238_10001442 3300009551 Bacteria 23898
26 Ga0105239_10000733 3300010375 Bacteria 46597
27 Ga0105239_10018523 3300010375 Bacteria 7690
28 Ga0105239_10048484 3300010375 Bacteria 4658
29 Ga0157370_10007427 3300013104 Bacteria 11928
30 Ga0157369_10012507 3300013105 Bacteria 9628
31 Ga0157369_10016210 3300013105 Bacteria 8387
32 Ga0157372_10006384 3300013307 Bacteria 12545
33 Ga0213872_10000890 3300021361 Bacteria 21520
34 Ga0213872_10008495 3300021361 Bacteria 4968
35 Ga0213876_10000207 3300021384 Bacteria 59253
36 Ga0213876_10000483 3300021384 Bacteria 31487
37 Ga0213871_10000366 3300021441 Bacteria 5891
38 Ga0213871_10001324 3300021441 Bacteria 4088
39 Ga0209233_1000045 3300025261 Bacteria 473379
40 Ga0209758_1000008 3300025297 Bacteria 1215263
41 Ga0207680_10002065 3300025903 Bacteria 9407
42 Ga0207699_10000133 3300025906 Bacteria 50958
43 Ga0207707_10000001 3300025912 Bacteria 1212482
44 Ga0207695_10000004 3300025913 Bacteria 1288665
45 Ga0207695_10009649 3300025913 Bacteria 11901
46 Ga0207695_10013897 3300025913 Bacteria 9571
47 Ga0207693_10000035 3300025915 Bacteria 110713
48 Ga0207693_10000145 3300025915 Bacteria 65383
49 Ga0207693_10013219 3300025915 Bacteria 6661
50 Ga0207660_10000343 3300025917 Bacteria 30105
51 Ga0207649_10000109 3300025920 Bacteria 69042
52 Ga0207652_10001611 3300025921 Bacteria 19837
53 Ga0207652_10026139 3300025921 Bacteria 4859
54 Ga0207694_10000010 3300025924 Bacteria 439722
55 Ga0207700_10000887 3300025928 Bacteria 17225
56 Ga0207664_10003543 3300025929 Bacteria 10426
57 Ga0207690_10017462 3300025932 Bacteria 4381
58 Ga0207711_10000001 3300025941 Bacteria 1325674
59 Ga0207667_10000065 3300025949 Bacteria 186655
60 Ga0207667_10036377 3300025949 Bacteria 5277
61 Ga0207703_10007826 3300026035 Bacteria 8451
62 Ga0207639_10035966 3300026041 Bacteria 3667
63 Ga0207702_10000007 3300026078 Bacteria 332551
64 Ga0207702_10000012 3300026078 Bacteria 269770
65 Ga0207702_10011830 3300026078 Bacteria 7262
66 Ga0207648_10022975 3300026089 Bacteria 5591
67 Ga0207674_10000107 3300026116 Bacteria 95635
68 Ga0207683_10037589 3300026121 Bacteria 4216
69 Ga0268266_10000329 3300028379 Bacteria 74608
70 Ga0265318_10000082 3300028577 Bacteria 85943
71 Ga0265338_10000006 3300028800 Bacteria 570804
72 Ga0265338_10001374 3300028800 Bacteria 39593
73 Ga0265324_10002968 3300029957 Bacteria 8299
74 Ga0265320_10000039 3300031240 Bacteria 134478
75 Ga0265325_10000007 3300031241 Bacteria 208874
76 Ga0265325_10000079 3300031241 Bacteria 67833
77 Ga0265339_10000909 3300031249 Bacteria 22749
78 Ga0265339_10001422 3300031249 Bacteria 17761
79 Ga0265339_10010176 3300031249 Bacteria 5856
80 Ga0265331_10000002 3300031250 Bacteria 511481
81 Ga0265331_10000107 3300031250 Bacteria 112221
82 Ga0265331_10000341 3300031250 Bacteria 49637
83 Ga0265331_10005387 3300031250 Bacteria 7735
84 Ga0265327_10000052 3300031251 Bacteria 256602
85 Ga0265327_10000070 3300031251 Bacteria 217350
86 Ga0265313_10000529 3300031595 Bacteria 39938
87 Ga0265313_10001902 3300031595 Bacteria 18946
88 Ga0265313_10011735 3300031595 Bacteria 5424
89 Ga0265314_10007438 3300031711 Bacteria 9501
90 Ga0265314_10014433 3300031711 Bacteria 6321
91 Ga0373935_0018363 3300035692 Bacteria 4253
92 Ga0373937_0000312 3300036401 Bacteria 45975
93 Ga0373937_0002034 3300036401 Bacteria 16886
94 Ga0373925_0032070 3300037068 Bacteria 3865
95 Ga0436364_0093921 3300037853 Bacteria 15238
96 Ga0436364_0793334 3300037853 Bacteria 6588
97 Ga0436364_1226252 3300037853 Bacteria 5266
98 Ga0436364_1386611 3300037853 Bacteria 4910
99 Ga0436365_0093392 3300039437 Bacteria 124820
100 Ga0436365_0991473 3300039437 Bacteria 77252
101 Ga0436365_1235220 3300039437 Bacteria 3580
102 Ga0436360_0214003 3300039438 Bacteria 6237
103 Ga0436361_0118198 3300039447 Bacteria 4260
104 Ga0436363_1427882 3300039450 Bacteria 4384
105 Ga0453684_0033968 3300044712 Bacteria 7093
106 Ga0466957_0011942 3300044842 Bacteria 5022
107 Ga0451576_0010033 3300045051 Bacteria 10906
108 Ga0495608_0026524 3300046511 Bacteria 3949
109 Ga0495645_0007482 3300046543 Bacteria 7604
110 Ga0495667_0007666 3300046559 Bacteria 7324
111 Ga0495674_0049759 3300047319 Bacteria 3701
112 Ga0495675_0023377 3300047444 Bacteria 3937
113 Ga0495684_0045292 3300047471 Bacteria 3367
114 Ga0495602_0000195 3300048088 Bacteria 57149
115 Ga0496119_0003055 3300048922 Bacteria 17709
116 Ga0496121_0000342 3300048924 Bacteria 97267
117 Ga0496126_0003233 3300048929 Bacteria 20835
118 Ga0501031_0007188 3300049568 Bacteria 7265
119 Ga0501032_0013219 3300049569 Bacteria 5873
120 Ga0501033_0009915 3300049570 Bacteria 7315
121 Ga0501033_0012319 3300049570 Bacteria 6527
122 Ga0501033_0022868 3300049570 Bacteria 4713
123 Ga0501033_0031373 3300049570 Bacteria 3993
124 Ga0501033_0038683 3300049570 Bacteria 3564
125 Ga0501034_0045173 3300049571 Bacteria 4452
126 Ga0501034_0063318 3300049571 Bacteria 3712
127 Ga0501036_0003979 3300049572 Bacteria 11875
128 Ga0501037_0003258 3300049573 Bacteria 11780
129 Ga0501037_0018910 3300049573 Bacteria 5078
130 Ga0501039_0000722 3300049575 Bacteria 23835
131 Ga0501046_0014189 3300049580 Bacteria 6730
132 Ga0501067_0000729 3300049583 Bacteria 17689
133 Ga0501067_0008239 3300049583 Bacteria 5787
134 Ga0501070_0009201 3300049586 Bacteria 8352
135 Ga0501070_0017105 3300049586 Bacteria 6085
136 Ga0501072_0008933 3300049588 Bacteria 7617
137 Ga0501072_0051928 3300049588 Bacteria 3228
138 Ga0501073_0011732 3300049589 Bacteria 6398
139 Ga0501074_0006832 3300049590 Bacteria 8245
140 Ga0501079_0001593 3300049741 Bacteria 16128
141 Ga0501035_0022049 3300049822 Bacteria 5851
142 Ga0501035_0024726 3300049822 Bacteria 5506
143 Ga0501044_0015626 3300049823 Bacteria 8175
144 Ga0501045_0028932 3300049824 Bacteria 4000
145 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
146 Ga0500643_000006 3300053087 Bacteria 479605
147 Ga0500595_004083 3300053119 Bacteria 6629
148 Ga0500573_0000009 3300053140 Bacteria 230823
149 Ga0501084_0019028 3300054114 Bacteria 5718
150 Ga0501084_0022141 3300054114 Bacteria 5302
151 Ga0501082_0042705 3300060353 Bacteria 3908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0032070 Ga0373925_0032070_1208_3823 863
2 3300037853 Ga0436364_1226252 Ga0436364_1226252_1475_4345 904
3 3300021361 Ga0213872_10000890 Ga0213872_1000089010 923
4 3300039437 Ga0436365_1235220 Ga0436365_1235220_475_3357 929
5 3300021361 Ga0213872_10008495 Ga0213872_100084952 930
6 3300037853 Ga0436364_1386611 Ga0436364_1386611_1312_4161 930
7 3300039447 Ga0436361_0118198 Ga0436361_0118198_1110_4049 930
8 3300021441 Ga0213871_10001324 Ga0213871_100013242 937
9 3300031251 Ga0265327_10000070 Ga0265327_1000007025 937
10 3300037853 Ga0436364_0793334 Ga0436364_0793334_2704_5595 937
11 3300044712 Ga0453684_0033968 Ga0453684_0033968_1443_4394 937
12 3300021441 Ga0213871_10000366 Ga0213871_100003662 943
13 3300037853 Ga0436364_0093921 Ga0436364_0093921_9052_11913 943
14 3300039438 Ga0436360_0214003 Ga0436360_0214003_2349_5207 943
15 3300044842 Ga0466957_0011942 Ga0466957_0011942_12_2945 943
16 3300045051 Ga0451576_0010033 Ga0451576_0010033_7778_10702 944
17 iso_pu_bacteria 8055909800 8055916190 946
18 3300003215 JGI25153J46596_10000498 JGI25153J46596_1000049822 947
19 3300025297 Ga0209758_1000008 Ga0209758_1000008961 947
20 3300005336 Ga0070680_100028166 Ga0070680_1000281662 948
21 3300005530 Ga0070679_100041422 Ga0070679_1000414221 948
22 3300005548 Ga0070665_100001530 Ga0070665_10000153013 948
23 3300028379 Ga0268266_10000329 Ga0268266_100003295 948
24 3300035692 Ga0373935_0018363 Ga0373935_0018363_41_2914 948
25 3300053140 Ga0500573_0000009 Ga0500573_0000009_23700_26663 948
26 3300025915 Ga0207693_10013219 Ga0207693_100132192 949
27 3300025921 Ga0207652_10026139 Ga0207652_100261392 949
28 3300029957 Ga0265324_10002968 Ga0265324_100029683 949
29 3300031250 Ga0265331_10000107 Ga0265331_1000010753 949
30 3300031595 Ga0265313_10000529 Ga0265313_1000052927 949
31 3300036401 Ga0373937_0000312 Ga0373937_0000312_30738_33614 949
32 3300036401 Ga0373937_0002034 Ga0373937_0002034_4789_7665 949
33 3300046511 Ga0495608_0026524 Ga0495608_0026524_384_3260 949
34 3300046543 Ga0495645_0007482 Ga0495645_0007482_4350_7226 949
35 3300046559 Ga0495667_0007666 Ga0495667_0007666_2945_5821 949
36 3300047444 Ga0495675_0023377 Ga0495675_0023377_358_3234 949
37 3300047471 Ga0495684_0045292 Ga0495684_0045292_198_3074 949
38 3300048088 Ga0495602_0000195 Ga0495602_0000195_24607_27483 949
39 3300048922 Ga0496119_0003055 Ga0496119_0003055_9069_11945 949
40 3300049570 Ga0501033_0022868 Ga0501033_0022868_528_3413 949
41 3300049573 Ga0501037_0018910 Ga0501037_0018910_1429_4314 949
42 3300026041 Ga0207639_10035966 Ga0207639_100359662 950
43 3300047319 Ga0495674_0049759 Ga0495674_0049759_82_2976 950
44 3300060353 Ga0501082_0042705 Ga0501082_0042705_707_3667 950
45 3300028800 Ga0265338_10001374 Ga0265338_100013747 953
46 3300031711 Ga0265314_10007438 Ga0265314_100074381 953
47 3300031250 Ga0265331_10005387 Ga0265331_100053872 955
48 3300031595 Ga0265313_10011735 Ga0265313_100117354 955
49 3300053119 Ga0500595_004083 Ga0500595_004083_1313_4285 956
50 3300048924 Ga0496121_0000342 Ga0496121_0000342_67976_70954 957
51 iso_pu_bacteria 2713897090 2715501745 957
52 iso_pu_bacteria 2855020534 2855022427 957
53 iso_pu_bacteria 2899275550 2899276005 957
54 iso_pu_bacteria 8057132660 8057135278 957
55 3300049570 Ga0501033_0012319 Ga0501033_0012319_135_3080 962
56 3300049570 Ga0501033_0031373 Ga0501033_0031373_298_3252 962
57 3300025929 Ga0207664_10003543 Ga0207664_100035433 963
58 3300049568 Ga0501031_0007188 Ga0501031_0007188_2628_5588 966
59 3300049569 Ga0501032_0013219 Ga0501032_0013219_1602_4562 966
60 3300049572 Ga0501036_0003979 Ga0501036_0003979_2529_5489 966
61 3300049573 Ga0501037_0003258 Ga0501037_0003258_2434_5394 966
62 3300049575 Ga0501039_0000722 Ga0501039_0000722_19038_21998 966
63 3300049580 Ga0501046_0014189 Ga0501046_0014189_1926_4892 966
64 3300049583 Ga0501067_0000729 Ga0501067_0000729_5104_8064 966
65 3300049586 Ga0501070_0017105 Ga0501070_0017105_1730_4690 966
66 3300049588 Ga0501072_0051928 Ga0501072_0051928_156_3116 966
67 3300049590 Ga0501074_0006832 Ga0501074_0006832_2344_5304 966
68 3300049741 Ga0501079_0001593 Ga0501079_0001593_10875_13835 966
69 3300049824 Ga0501045_0028932 Ga0501045_0028932_904_3864 966
70 3300054114 Ga0501084_0019028 Ga0501084_0019028_1778_4738 966
71 3300013307 Ga0157372_10006384 Ga0157372_100063843 967
72 3300021384 Ga0213876_10000207 Ga0213876_1000020716 967
73 3300028577 Ga0265318_10000082 Ga0265318_1000008277 967
74 3300039437 Ga0436365_0093392 Ga0436365_0093392_66159_69080 967
75 3300049571 Ga0501034_0045173 Ga0501034_0045173_195_3146 967
76 3300010375 Ga0105239_10000733 Ga0105239_1000073327 968
77 3300025913 Ga0207695_10013897 Ga0207695_100138974 968
78 3300031240 Ga0265320_10000039 Ga0265320_1000003922 968
79 3300031249 Ga0265339_10010176 Ga0265339_100101763 968
80 3300005563 Ga0068855_100000034 Ga0068855_1000000343 969
81 3300009093 Ga0105240_10015089 Ga0105240_100150892 969
82 3300010375 Ga0105239_10018523 Ga0105239_100185236 969
83 3300013105 Ga0157369_10012507 Ga0157369_100125073 969
84 3300025913 Ga0207695_10000004 Ga0207695_10000004982 969
85 3300025924 Ga0207694_10000010 Ga0207694_1000001022 969
86 3300025949 Ga0207667_10000065 Ga0207667_10000065206 969
87 3300026089 Ga0207648_10022975 Ga0207648_100229752 969
88 3300026121 Ga0207683_10037589 Ga0207683_100375892 969
89 3300039450 Ga0436363_1427882 Ga0436363_1427882_1382_4309 969
90 3300005335 Ga0070666_10000186 Ga0070666_1000018636 970
91 3300005336 Ga0070680_100000132 Ga0070680_10000013237 970
92 3300005434 Ga0070709_10008977 Ga0070709_100089774 970
93 3300005436 Ga0070713_100000002 Ga0070713_1000000029 970
94 3300005539 Ga0068853_100003994 Ga0068853_1000039944 970
95 3300005563 Ga0068855_100037139 Ga0068855_1000371392 970
96 3300005577 Ga0068857_100000488 Ga0068857_10000048818 970
97 3300005614 Ga0068856_100000312 Ga0068856_10000031251 970
98 3300005614 Ga0068856_100013259 Ga0068856_1000132595 970
99 3300005842 Ga0068858_100002481 Ga0068858_10000248117 970
100 3300006175 Ga0070712_100000272 Ga0070712_1000002726 970
101 3300006914 Ga0075436_100000098 Ga0075436_10000009844 970
102 3300009093 Ga0105240_10008350 Ga0105240_100083504 970
103 3300009177 Ga0105248_10000001 Ga0105248_10000001611 970
104 3300009545 Ga0105237_10001328 Ga0105237_1000132839 970
105 3300009551 Ga0105238_10001442 Ga0105238_1000144215 970
106 3300010375 Ga0105239_10048484 Ga0105239_100484842 970
107 3300013104 Ga0157370_10007427 Ga0157370_100074271 970
108 3300013105 Ga0157369_10016210 Ga0157369_100162105 970
109 3300021384 Ga0213876_10000483 Ga0213876_100004834 970
110 3300025903 Ga0207680_10002065 Ga0207680_100020658 970
111 3300025906 Ga0207699_10000133 Ga0207699_1000013349 970
112 3300025912 Ga0207707_10000001 Ga0207707_10000001661 970
113 3300025913 Ga0207695_10009649 Ga0207695_1000964910 970
114 3300025915 Ga0207693_10000035 Ga0207693_1000003562 970
115 3300025915 Ga0207693_10000145 Ga0207693_1000014524 970
116 3300025917 Ga0207660_10000343 Ga0207660_1000034322 970
117 3300025921 Ga0207652_10001611 Ga0207652_100016116 970
118 3300025928 Ga0207700_10000887 Ga0207700_100008879 970
119 3300025941 Ga0207711_10000001 Ga0207711_100000011260 970
120 3300025949 Ga0207667_10036377 Ga0207667_100363773 970
121 3300026035 Ga0207703_10007826 Ga0207703_100078267 970
122 3300026078 Ga0207702_10000007 Ga0207702_10000007120 970
123 3300026078 Ga0207702_10000012 Ga0207702_1000001251 970
124 3300026078 Ga0207702_10011830 Ga0207702_100118304 970
125 3300026116 Ga0207674_10000107 Ga0207674_1000010742 970
126 3300028800 Ga0265338_10000006 Ga0265338_10000006207 970
127 3300031241 Ga0265325_10000007 Ga0265325_10000007208 970
128 3300031241 Ga0265325_10000079 Ga0265325_1000007957 970
129 3300031249 Ga0265339_10000909 Ga0265339_1000090925 970
130 3300031249 Ga0265339_10001422 Ga0265339_1000142210 970
131 3300031595 Ga0265313_10001902 Ga0265313_1000190214 970
132 3300031711 Ga0265314_10014433 Ga0265314_100144333 970
133 3300039437 Ga0436365_0991473 Ga0436365_0991473_36528_39455 970
134 3300048929 Ga0496126_0003233 Ga0496126_0003233_15642_18572 970
135 3300050514 nmdc:mga08x19_99_c1 nmdc:mga08x19_99_c1_61506_64436 970
136 3300053087 Ga0500643_000006 Ga0500643_000006_50243_53233 970
137 3300005344 Ga0070661_100004139 Ga0070661_1000041398 971
138 3300025920 Ga0207649_10000109 Ga0207649_1000010959 971
139 3300031250 Ga0265331_10000002 Ga0265331_10000002297 971
140 3300031250 Ga0265331_10000341 Ga0265331_1000034114 971
141 3300031251 Ga0265327_10000052 Ga0265327_1000005214 971
142 3300049570 Ga0501033_0038683 Ga0501033_0038683_402_3338 971
143 3300049571 Ga0501034_0063318 Ga0501034_0063318_660_3596 971
144 3300049583 Ga0501067_0008239 Ga0501067_0008239_1134_4067 971
145 3300049586 Ga0501070_0009201 Ga0501070_0009201_2184_5117 971
146 3300049588 Ga0501072_0008933 Ga0501072_0008933_4342_7275 971
147 3300049589 Ga0501073_0011732 Ga0501073_0011732_3116_6049 971
148 3300049823 Ga0501044_0015626 Ga0501044_0015626_2411_5344 971
149 3300054114 Ga0501084_0022141 Ga0501084_0022141_1467_4400 971
150 3300003214 JGI25165J46597_1000047 JGI25165J46597_1000047203 973
151 3300003214 JGI25165J46597_1000066 JGI25165J46597_1000066124 973
152 3300025261 Ga0209233_1000045 Ga0209233_1000045310 973
153 3300025932 Ga0207690_10017462 Ga0207690_100174623 973
154 3300049570 Ga0501033_0009915 Ga0501033_0009915_844_3795 973
155 3300049822 Ga0501035_0022049 Ga0501035_0022049_1609_4575 973
156 3300049822 Ga0501035_0024726 Ga0501035_0024726_1371_4322 973

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

630

826

0.98

PF16078

2-oxogl_dehyd_N

2-oxoglutarate dehydrogenase N-terminus

21

61

0.96

PF16870

OxoGdeHyase_C

2-oxoglutarate dehydrogenase C-terminal

829

984

0.95

PF00676

E1_dh

Dehydrogenase E1 component

240

565

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jgd-assembly1.cif.gz_B e. coli 2-oxoglutarate dehydrogenase (e1o) 0.9314 108 973
6kma-assembly1.cif.gz_B crystal structure of suca with glycolaldehyde-1-13c from vibrio vulnificus 0.9304 109 973
2jgd-assembly1.cif.gz_A e. coli 2-oxoglutarate dehydrogenase (e1o) 0.9294 108 973
6kma-assembly2.cif.gz_D crystal structure of suca with glycolaldehyde-1-13c from vibrio vulnificus 0.9293 109 973
6kma-assembly1.cif.gz_A crystal structure of suca with glycolaldehyde-1-13c from vibrio vulnificus 0.9291 111 973
ID Description Score Start End Superfamily
af_Q54JE4_868_1008_3.40.50.11610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Multifunctional 2-oxoglutarate metabolism enzyme, C-terminal domain 0.9535 827 972 3.40.50.11610
af_Q54JE4_868_1008_3.40.50.11610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Multifunctional 2-oxoglutarate metabolism enzyme, C-terminal domain 0.934 827 972 3.40.50.11610
af_O74378_868_1008_3.40.50.11610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Multifunctional 2-oxoglutarate metabolism enzyme, C-terminal domain 0.9331 827 970 3.40.50.11610
af_P20967_212_578_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9328 190 554 3.40.50.970
af_O74378_600_867_3.40.50.12470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9264 575 823 3.40.50.12470
ID Description Score Start End GO Terms
AF-A0A4S0IGE5-F1-model_v4 deleted 0.9809 779 922
AF-A0A519JMT2-F1-model_v4 oxoglutarate dehydrogenase (succinyl-transferring) (EC 1.2.4.2) 0.9677 778 972 GO:0004591
GO:0005829
GO:0006099
GO:0030976
GO:0045252
AF-A0A529NR50-F1-model_v4 oxoglutarate dehydrogenase (succinyl-transferring) (EC 1.2.4.2) 0.9643 750 942 GO:0004591
GO:0005829
GO:0006099
GO:0030976
GO:0045252
AF-A0A529NR50-F1-model_v4 oxoglutarate dehydrogenase (succinyl-transferring) (EC 1.2.4.2) 0.9546 750 942 GO:0004591
GO:0005829
GO:0006099
GO:0030976
GO:0045252
AF-A0A4S0IGE5-F1-model_v4 deleted 0.9546 779 922

Feature Viewer

pLDDT pTM Quality
75.98 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map