F226847

General Info

Members Datasets Scaffolds Average Seq Length
157 106 314 272

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100352662|Ga0068859_1003526622
Length 294
Sequence MKTAITISLVPQARQGPFVFHGDLPGSIAKAAALGFDAVEIFPPAADAILRSELRRMLLDHNLQLAAIGTGAGWVVQKLTLTDPDSSARAKAIDFVKGIIDLAGEFSAPAIIGSMQGRHANGETTGNPDADRKQTIDLLTDSISRLAAHAKTNHNTPLLYEPLNRYETNLFNRQINAADWLRLSKIENVRILADLFHMNIEEQDVVASLEQLGSLLGHVHFVDSNRQAPGWGHTDFAPIMAALRRINYTGYLSAECFPIPDTNVAAQQTITRYKELLESRFGVSQDDNLRDSSN

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 1.27
Rhizosphere 95.54
Stem 0
Stem Tuber 0
Unclassified 20.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100352662 3300005617 Unclassified 1566
2 Ga0065704_10078997 3300005289 Unclassified 4284
3 Ga0065712_10070889 3300005290 Bacteria 5627
4 Ga0065707_10138626 3300005295 Bacteria 1803
5 Ga0070690_100105125 3300005330 Bacteria 1876
6 Ga0070690_100129480 3300005330 Bacteria 1703
7 Ga0070670_100207212 3300005331 Bacteria 1704
8 Ga0070670_100273732 3300005331 Unclassified 1474
9 Ga0070689_100004084 3300005340 Bacteria 9833
10 Ga0070689_100004679 3300005340 Bacteria 9273
11 Ga0070689_100041272 3300005340 Unclassified 3542
12 Ga0070689_100147788 3300005340 Bacteria 1894
13 Ga0070689_100491918 3300005340 Bacteria 1049
14 Ga0070687_100015808 3300005343 Unclassified 3421
15 Ga0070661_100155141 3300005344 Unclassified 1732
16 Ga0070688_100006492 3300005365 Bacteria 6255
17 Ga0070688_100060431 3300005365 Bacteria 2393
18 Ga0070688_100159237 3300005365 Bacteria 1550
19 Ga0070714_100200973 3300005435 Bacteria 1823
20 Ga0070706_100211263 3300005467 Bacteria 1812
21 Ga0070707_100366384 3300005468 Bacteria 1400
22 Ga0068853_100000001 3300005539 Bacteria 715840
23 Ga0068853_100036728 3300005539 Bacteria 4167
24 Ga0070686_100084659 3300005544 Bacteria 2108
25 Ga0070704_100011671 3300005549 Bacteria 5396
26 Ga0070704_100574120 3300005549 Bacteria 988
27 Ga0068855_100020837 3300005563 Bacteria 7862
28 Ga0068855_100033573 3300005563 Bacteria 6122
29 Ga0068857_100001967 3300005577 Bacteria 16614
30 Ga0068857_100148392 3300005577 Bacteria 2123
31 Ga0068857_100207017 3300005577 Unclassified 1789
32 Ga0068859_100437405 3300005617 Bacteria 1404
33 Ga0068859_100524517 3300005617 Bacteria 1279
34 Ga0068858_100127742 3300005842 Bacteria 2382
35 Ga0075428_100020823 3300006844 Bacteria 7262
36 Ga0075430_100243014 3300006846 Bacteria 1492
37 Ga0075431_100042855 3300006847 Bacteria 4669
38 Ga0075434_100423879 3300006871 Unclassified 1352
39 Ga0097620_100352685 3300006931 Unclassified 1566
40 Ga0097620_100437437 3300006931 Bacteria 1404
41 Ga0097620_100524590 3300006931 Bacteria 1279
42 Ga0105240_10000149 3300009093 Bacteria 141753
43 Ga0105240_10187647 3300009093 Unclassified 2434
44 Ga0105240_10428506 3300009093 Unclassified 1484
45 Ga0105240_10747679 3300009093 Unclassified 1063
46 Ga0111539_10008564 3300009094 Bacteria 12987
47 Ga0111539_10010380 3300009094 Bacteria 11725
48 Ga0111539_10080491 3300009094 Bacteria 3832
49 Ga0111539_10150846 3300009094 Bacteria 2721
50 Ga0111539_10196360 3300009094 Bacteria 2354
51 Ga0111539_10385120 3300009094 Bacteria 1633
52 Ga0111539_10498122 3300009094 Unclassified 1419
53 Ga0105245_10090432 3300009098 Unclassified 2815
54 Ga0114129_10605144 3300009147 Unclassified 1419
55 Ga0105241_10306755 3300009174 Unclassified 1364
56 Ga0105248_10206496 3300009177 Unclassified 2213
57 Ga0105248_10545952 3300009177 Bacteria 1307
58 Ga0105248_10627613 3300009177 Bacteria 1212
59 Ga0105248_11204577 3300009177 Bacteria 856
60 Ga0105239_10025798 3300010375 Bacteria 6472
61 Ga0105239_10042031 3300010375 Bacteria 5008
62 Ga0157370_10135732 3300013104 Bacteria 2293
63 Ga0157370_10156807 3300013104 Bacteria 2118
64 Ga0157369_10069758 3300013105 Bacteria 3776
65 Ga0157369_10631305 3300013105 Bacteria 1105
66 Ga0157374_10107037 3300013296 Unclassified 2687
67 Ga0157372_10005446 3300013307 Bacteria 13526
68 Ga0157372_10039261 3300013307 Bacteria 5225
69 Ga0157375_10000017 3300013308 Bacteria 286152
70 Ga0157375_10994903 3300013308 Bacteria 978
71 Ga0163163_10000018 3300014325 Bacteria 199503
72 Ga0213873_10003773 3300021358 Bacteria 2767
73 Ga0213872_10060887 3300021361 Bacteria 1707
74 Ga0213876_10072331 3300021384 Bacteria 1821
75 Ga0213871_10011241 3300021441 Bacteria 2051
76 Ga0209050_1001216 3300025298 Bacteria 30057
77 Ga0207695_10000562 3300025913 Bacteria 76120
78 Ga0207695_10000671 3300025913 Bacteria 67382
79 Ga0207662_10086409 3300025918 Bacteria 1922
80 Ga0207649_10082094 3300025920 Unclassified 2089
81 Ga0207650_10193331 3300025925 Bacteria 1627
82 Ga0207650_10248358 3300025925 Bacteria 1440
83 Ga0207670_10027319 3300025936 Unclassified 3606
84 Ga0207670_10052024 3300025936 Unclassified 2753
85 Ga0207670_10122433 3300025936 Bacteria 1893
86 Ga0207667_10018811 3300025949 Bacteria 7735
87 Ga0207667_10369731 3300025949 Unclassified 1461
88 Ga0207703_10091557 3300026035 Bacteria 2558
89 Ga0207639_10000001 3300026041 Bacteria 1431562
90 Ga0207639_10026489 3300026041 Bacteria 4214
91 Ga0207641_10166441 3300026088 Unclassified 2008
92 Ga0207641_10556597 3300026088 Unclassified 1119
93 Ga0207674_10033634 3300026116 Bacteria 5366
94 Ga0207674_10182266 3300026116 Bacteria 2051
95 Ga0207683_10008424 3300026121 Bacteria 8824
96 Ga0207698_10535860 3300026142 Bacteria 1145
97 Ga0207428_10052998 3300027907 Bacteria 3236
98 Ga0265338_10006262 3300028800 Bacteria 15226
99 Ga0265338_10018583 3300028800 Bacteria 7429
100 Ga0265332_10020290 3300031238 Bacteria 2933
101 Ga0265325_10000418 3300031241 Bacteria 30394
102 Ga0265339_10000848 3300031249 Bacteria 23552
103 Ga0265331_10000359 3300031250 Bacteria 47833
104 Ga0265313_10003237 3300031595 Bacteria 13385
105 Ga0265314_10000561 3300031711 Bacteria 47451
106 Ga0265342_10002306 3300031712 Bacteria 16582
107 Ga0373944_0029008 3300035089 Bacteria 1651
108 Ga0373952_0013425 3300035092 Bacteria 1625
109 Ga0373923_0171365 3300035111 Bacteria 994
110 Ga0373945_0051068 3300035116 Bacteria 1521
111 Ga0373953_0083221 3300035117 Bacteria 1333
112 Ga0373931_0060321 3300035691 Bacteria 2042
113 Ga0436365_0994503 3300039437 Bacteria 9211
114 Ga0436360_1155867 3300039438 Bacteria 5635
115 Ga0436361_0544416 3300039447 Bacteria 7851
116 Ga0436362_0042781 3300039453 Bacteria 15641
117 Ga0451807_0721530 3300041486 Bacteria 1664
118 Ga0451577_0189382 3300042876 Bacteria 1856
119 Ga0453684_0769460 3300044712 Unclassified 1041
120 Ga0451576_0152588 3300045051 Bacteria 2409
121 Ga0451576_0251502 3300045051 Bacteria 1847
122 Ga0451576_0665405 3300045051 Unclassified 1094
123 Ga0451576_0674963 3300045051 Unclassified 1086
124 Ga0495639_0106581 3300046475 Bacteria 1327
125 Ga0495664_0082368 3300046477 Bacteria 1930
126 Ga0495608_0287235 3300046511 Bacteria 1020
127 Ga0495618_0196409 3300046514 Bacteria 1278
128 Ga0495630_0002449 3300046517 Bacteria 12840
129 Ga0495630_0263482 3300046517 Bacteria 1316
130 Ga0495643_0000222 3300046522 Bacteria 87312
131 Ga0495666_0042870 3300046526 Bacteria 2187
132 Ga0495586_0023449 3300046535 Bacteria 3296
133 Ga0495586_0136939 3300046535 Bacteria 1373
134 Ga0495635_0372237 3300046663 Unclassified 951
135 Ga0495599_0077584 3300046678 Bacteria 2074
136 Ga0495658_0015560 3300046683 Bacteria 3903
137 Ga0495658_0169618 3300046683 Bacteria 1350
138 Ga0495613_0350596 3300046689 Unclassified 1014
139 Ga0495581_0052567 3300047315 Bacteria 2353
140 Ga0495674_0005234 3300047319 Bacteria 12454
141 Ga0495676_0107564 3300047321 Bacteria 2053
142 Ga0495680_0239477 3300047322 Bacteria 1289
143 Ga0496114_0574733 3300048917 Bacteria 995
144 Ga0501034_0012243 3300049571 Bacteria 8864
145 Ga0501046_0375174 3300049580 Bacteria 1030
146 Ga0501048_0062352 3300049582 Bacteria 2639
147 Ga0501075_0320871 3300049591 Bacteria 1180
148 Ga0501076_0499432 3300049592 Bacteria 1003
149 nmdc:mga05p37_741252_c1 3300050507 Unclassified 1084
150 nmdc:mga0qj67_298262_c1 3300050509 Bacteria 1306
151 nmdc:mga06r32_32255_c1 3300050510 Bacteria 4927
152 nmdc:mga08y16_15603_c1 3300050511 Bacteria 7988
153 nmdc:mga08y16_48251_c1 3300050511 Unclassified 4456
154 nmdc:mga08y16_68455_c1 3300050511 Bacteria 3701
155 nmdc:mga0rr50_220798_c1 3300050513 Unclassified 1565
156 Ga0500616_0001701 3300053153 Bacteria 20234
157 2687239135 2684623219 Bacteria 8442773
158 Ga0068859_100352662
159 Ga0065704_10078997
160 Ga0065712_10070889
161 Ga0065707_10138626
162 Ga0070690_100105125
163 Ga0070690_100129480
164 Ga0070670_100207212
165 Ga0070670_100273732
166 Ga0070689_100004084
167 Ga0070689_100004679
168 Ga0070689_100041272
169 Ga0070689_100147788
170 Ga0070689_100491918
171 Ga0070687_100015808
172 Ga0070661_100155141
173 Ga0070688_100006492
174 Ga0070688_100060431
175 Ga0070688_100159237
176 Ga0070714_100200973
177 Ga0070706_100211263
178 Ga0070707_100366384
179 Ga0068853_100000001
180 Ga0068853_100036728
181 Ga0070686_100084659
182 Ga0070704_100011671
183 Ga0070704_100574120
184 Ga0068855_100020837
185 Ga0068855_100033573
186 Ga0068857_100001967
187 Ga0068857_100148392
188 Ga0068857_100207017
189 Ga0068859_100437405
190 Ga0068859_100524517
191 Ga0068858_100127742
192 Ga0075428_100020823
193 Ga0075430_100243014
194 Ga0075431_100042855
195 Ga0075434_100423879
196 Ga0097620_100352685
197 Ga0097620_100437437
198 Ga0097620_100524590
199 Ga0105240_10000149
200 Ga0105240_10187647
201 Ga0105240_10428506
202 Ga0105240_10747679
203 Ga0111539_10008564
204 Ga0111539_10010380
205 Ga0111539_10080491
206 Ga0111539_10150846
207 Ga0111539_10196360
208 Ga0111539_10385120
209 Ga0111539_10498122
210 Ga0105245_10090432
211 Ga0114129_10605144
212 Ga0105241_10306755
213 Ga0105248_10206496
214 Ga0105248_10545952
215 Ga0105248_10627613
216 Ga0105248_11204577
217 Ga0105239_10025798
218 Ga0105239_10042031
219 Ga0157370_10135732
220 Ga0157370_10156807
221 Ga0157369_10069758
222 Ga0157369_10631305
223 Ga0157374_10107037
224 Ga0157372_10005446
225 Ga0157372_10039261
226 Ga0157375_10000017
227 Ga0157375_10994903
228 Ga0163163_10000018
229 Ga0213873_10003773
230 Ga0213872_10060887
231 Ga0213876_10072331
232 Ga0213871_10011241
233 Ga0209050_1001216
234 Ga0207695_10000562
235 Ga0207695_10000671
236 Ga0207662_10086409
237 Ga0207649_10082094
238 Ga0207650_10193331
239 Ga0207650_10248358
240 Ga0207670_10027319
241 Ga0207670_10052024
242 Ga0207670_10122433
243 Ga0207667_10018811
244 Ga0207667_10369731
245 Ga0207703_10091557
246 Ga0207639_10000001
247 Ga0207639_10026489
248 Ga0207641_10166441
249 Ga0207641_10556597
250 Ga0207674_10033634
251 Ga0207674_10182266
252 Ga0207683_10008424
253 Ga0207698_10535860
254 Ga0207428_10052998
255 Ga0265338_10006262
256 Ga0265338_10018583
257 Ga0265332_10020290
258 Ga0265325_10000418
259 Ga0265339_10000848
260 Ga0265331_10000359
261 Ga0265313_10003237
262 Ga0265314_10000561
263 Ga0265342_10002306
264 Ga0373944_0029008
265 Ga0373952_0013425
266 Ga0373923_0171365
267 Ga0373945_0051068
268 Ga0373953_0083221
269 Ga0373931_0060321
270 Ga0436365_0994503
271 Ga0436360_1155867
272 Ga0436361_0544416
273 Ga0436362_0042781
274 Ga0451807_0721530
275 Ga0451577_0189382
276 Ga0453684_0769460
277 Ga0451576_0152588
278 Ga0451576_0251502
279 Ga0451576_0665405
280 Ga0451576_0674963
281 Ga0495639_0106581
282 Ga0495664_0082368
283 Ga0495608_0287235
284 Ga0495618_0196409
285 Ga0495630_0002449
286 Ga0495630_0263482
287 Ga0495643_0000222
288 Ga0495666_0042870
289 Ga0495586_0023449
290 Ga0495586_0136939
291 Ga0495635_0372237
292 Ga0495599_0077584
293 Ga0495658_0015560
294 Ga0495658_0169618
295 Ga0495613_0350596
296 Ga0495581_0052567
297 Ga0495674_0005234
298 Ga0495676_0107564
299 Ga0495680_0239477
300 Ga0496114_0574733
301 Ga0501034_0012243
302 Ga0501046_0375174
303 Ga0501048_0062352
304 Ga0501075_0320871
305 Ga0501076_0499432
306 nmdc:mga05p37_741252_c1
307 nmdc:mga0qj67_298262_c1
308 nmdc:mga06r32_32255_c1
309 nmdc:mga08y16_15603_c1
310 nmdc:mga08y16_48251_c1
311 nmdc:mga08y16_68455_c1
312 nmdc:mga0rr50_220798_c1
313 Ga0500616_0001701
314 2687239135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

28

276

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.956 1 272
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.9524 1 272
5h6h-assembly2.cif.gz_B crystal structure of hyperthermophilic thermotoga maritima l-ribulose 3-epimerase with mn2+ 0.9209 2 272
5h6h-assembly2.cif.gz_B crystal structure of hyperthermophilic thermotoga maritima l-ribulose 3-epimerase with mn2+ 0.9175 2 272
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.855 2 272
ID Description Score Start End Superfamily
5h1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9204 1 271 3.20.20.150
5h1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9105 1 271 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8632 2 268 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.857 2 268 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8469 5 272 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3B8ZGW7-F1-model_v4 Sugar phosphate isomerase 0.9899 2 271 GO:0016853
AF-A0A7C1PH07-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9898 2 272 GO:0016853
AF-A0A2E2RCA6-F1-model_v4 Sugar phosphate isomerase 0.9895 1 269 GO:0016853
AF-A0A6I1K4Q6-F1-model_v4 Xylose isomerase domain-containing protein TIM barrel 0.9887 2 270 GO:0016853
AF-A0A6I1K4Q6-F1-model_v4 Xylose isomerase domain-containing protein TIM barrel 0.985 2 270 GO:0016853

Map