F227641

General Info

Members Datasets Scaffolds Average Seq Length
157 126 314 210

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10131601|Ga0316575_101316011
Length 230
Sequence MSNKKSWANDAPVAAATHFHTEQEEFWAGRFGDDYASRNRGAQWIARNIAFCARVLQRTERIRSVIEFGANIGLNLQALRLLLPEAKLAAVEINEKAVSELRQLPDVEVHHQSILDYTGKQQYDLALIKGVLIHLEPDSLPQVYELLYRSSARYICLAEYYNPTPVEVPYRGHSHKLFKRDFTGEMMDRFKDLHLLDYGFVYRRDLHFPQDDVTWFLLRKGREPRGDSVL

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
83 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
101 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 2643221570 Acidovorax sp. Root568 Isolate Unclassified
125 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
126 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 1.27
Rhizoplane 0
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10131601 3300031665 Bacteria 1027
2 JGI25157J39369_1000440 3300002741 Bacteria 26544
3 rootL2_10239614 3300003322 Unclassified 3378
4 Ga0065704_10013916 3300005289 Bacteria 1464
5 Ga0070676_10028350 3300005328 Bacteria 3180
6 Ga0070683_100080839 3300005329 Bacteria 3042
7 Ga0070677_10060449 3300005333 Bacteria 1561
8 Ga0070680_100155618 3300005336 Bacteria 1920
9 Ga0070689_100871299 3300005340 Bacteria 795
10 Ga0070691_10005334 3300005341 Bacteria 5845
11 Ga0070692_10061607 3300005345 Bacteria 1978
12 Ga0070668_100145283 3300005347 Bacteria 1914
13 Ga0070669_100003667 3300005353 Bacteria 11080
14 Ga0070700_100370989 3300005441 Bacteria 1067
15 Ga0070662_100001266 3300005457 Bacteria 15519
16 Ga0070681_10040063 3300005458 Bacteria 4697
17 Ga0070681_10182600 3300005458 Bacteria 2019
18 Ga0070679_100027678 3300005530 Bacteria 5581
19 Ga0070684_100043860 3300005535 Bacteria 3864
20 Ga0070695_100648491 3300005545 Bacteria 833
21 Ga0070665_100221126 3300005548 Bacteria 1894
22 Ga0070665_100543932 3300005548 Bacteria 1173
23 Ga0068855_100008525 3300005563 Bacteria 12394
24 Ga0068855_100276241 3300005563 Bacteria 1867
25 Ga0068857_100083736 3300005577 Bacteria 2850
26 Ga0068854_100000737 3300005578 Bacteria 19380
27 Ga0070702_100155144 3300005615 Unclassified 1474
28 Ga0068852_100172967 3300005616 Unclassified 2026
29 Ga0068859_100076448 3300005617 Bacteria 3389
30 Ga0068866_10216757 3300005718 Bacteria 1152
31 Ga0068861_100000308 3300005719 Bacteria 27355
32 Ga0068861_100218661 3300005719 Bacteria 1609
33 Ga0068851_10036967 3300005834 Bacteria 2447
34 Ga0068862_100000651 3300005844 Bacteria 35850
35 Ga0068862_101246459 3300005844 Unclassified 743
36 Ga0075428_100523464 3300006844 Bacteria 1268
37 Ga0075430_100426286 3300006846 Unclassified 1095
38 Ga0075431_100031137 3300006847 Bacteria 5495
39 Ga0097620_100076447 3300006931 Bacteria 3389
40 Ga0079104_1000001 3300006946 Bacteria 521847
41 Ga0111539_10012557 3300009094 Bacteria 10615
42 Ga0111539_10294857 3300009094 Unclassified 1887
43 Ga0105243_10643974 3300009148 Bacteria 1026
44 Ga0105241_10215237 3300009174 Bacteria 1612
45 Ga0105238_10008607 3300009551 Bacteria 10209
46 Ga0105249_10023205 3300009553 Bacteria 5565
47 Ga0157371_10005271 3300013102 Bacteria 10958
48 Ga0157371_10118127 3300013102 Bacteria 1885
49 Ga0157370_10028176 3300013104 Bacteria 5529
50 Ga0157370_10057348 3300013104 Bacteria 3703
51 Ga0163162_10342359 3300013306 Bacteria 1628
52 Ga0213872_10104884 3300021361 Bacteria 1258
53 Ga0209026_1000139 3300025250 Bacteria 115298
54 Ga0209759_1002596 3300025256 Bacteria 7795
55 Ga0207656_10006112 3300025321 Bacteria 4310
56 Ga0207645_10138172 3300025907 Bacteria 1587
57 Ga0207707_10006872 3300025912 Bacteria 9923
58 Ga0207707_10127371 3300025912 Bacteria 2227
59 Ga0207681_10003217 3300025923 Bacteria 10239
60 Ga0207694_10009269 3300025924 Bacteria 7427
61 Ga0207690_10008306 3300025932 Bacteria 6158
62 Ga0207706_10006581 3300025933 Bacteria 10763
63 Ga0207670_10779986 3300025936 Bacteria 795
64 Ga0207667_10010932 3300025949 Bacteria 10578
65 Ga0207667_10230884 3300025949 Bacteria 1895
66 Ga0207712_10010934 3300025961 Bacteria 5775
67 Ga0207668_10055440 3300025972 Bacteria 2755
68 Ga0207640_10001329 3300025981 Bacteria 13410
69 Ga0207658_10656818 3300025986 Unclassified 945
70 Ga0207678_10539044 3300026067 Archaea 1020
71 Ga0207708_10447513 3300026075 Bacteria 1075
72 Ga0207674_10097592 3300026116 Bacteria 2922
73 Ga0207675_100002941 3300026118 Bacteria 16755
74 Ga0209281_1000151 3300027111 Bacteria 167268
75 Ga0207428_10095688 3300027907 Bacteria 2300
76 Ga0268266_10066503 3300028379 Bacteria 3118
77 Ga0268266_10368080 3300028379 Bacteria 1353
78 Ga0268265_10000794 3300028380 Bacteria 30047
79 Ga0268265_11185223 3300028380 Unclassified 761
80 Ga0268264_10910779 3300028381 Unclassified 883
81 Ga0307416_101551439 3300032002 Bacteria 768
82 Ga0307411_10101740 3300032005 Bacteria 2034
83 Ga0373923_0033246 3300035111 Bacteria 2088
84 Ga0373937_0093425 3300036401 Bacteria 2789
85 Ga0316582_0241683 3300036647 Bacteria 1237
86 Ga0395899_0000003 3300037312 Bacteria 1232684
87 Ga0395899_0001496 3300037312 Bacteria 19836
88 Ga0395900_0004588 3300037418 Bacteria 14581
89 Ga0395900_0010309 3300037418 Bacteria 9561
90 Ga0395898_0004438 3300037466 Bacteria 15342
91 Ga0395898_0134139 3300037466 Bacteria 2371
92 Ga0395905_0000469 3300037471 Bacteria 55742
93 Ga0395901_0005798 3300038443 Bacteria 12513
94 Ga0395901_0146994 3300038443 Unclassified 2477
95 Ga0436360_1181565 3300039438 Bacteria 757
96 Ga0436361_0132766 3300039447 Bacteria 1009
97 Ga0436361_0469102 3300039447 Bacteria 1555
98 Ga0436361_0847483 3300039447 Bacteria 808
99 Ga0436361_0922204 3300039447 Bacteria 2324
100 Ga0439465_0014225 3300041413 Bacteria 2480
101 Ga0439441_008215 3300042001 Bacteria 1699
102 Ga0439435_0051196 3300042436 Bacteria 1183
103 Ga0451577_0069580 3300042876 Bacteria 3138
104 Ga0451577_0276575 3300042876 Bacteria 1521
105 Ga0466969_0090561 3300044656 Bacteria 1450
106 Ga0453683_0003268 3300044673 Bacteria 12048
107 Ga0466964_0000077 3300044706 Bacteria 22114
108 Ga0453684_0004871 3300044712 Bacteria 27517
109 Ga0453684_0070495 3300044712 Bacteria 4426
110 Ga0453684_0125810 3300044712 Bacteria 3085
111 Ga0453684_0262579 3300044712 Bacteria 1977
112 Ga0453684_0710373 3300044712 Unclassified 1091
113 Ga0466959_0026440 3300045049 Bacteria 4301
114 Ga0451576_0010904 3300045051 Bacteria 10389
115 Ga0451576_0077479 3300045051 Unclassified 3460
116 Ga0451576_0096576 3300045051 Bacteria 3073
117 Ga0451576_0403490 3300045051 Unclassified 1433
118 Ga0466958_0496468 3300045836 Bacteria 792
119 Ga0495638_0004445 3300046460 Bacteria 10620
120 Ga0495605_0068976 3300046474 Bacteria 1675
121 Ga0495663_0003326 3300046525 Bacteria 4656
122 Ga0495598_0026943 3300046537 Bacteria 1581
123 Ga0495656_0010565 3300046615 Bacteria 3360
124 Ga0495625_0001626 3300046660 Bacteria 26485
125 Ga0495672_0017603 3300047320 Bacteria 4776
126 Ga0495685_024049 3300047447 Bacteria 2097
127 Ga0495673_0001179 3300047469 Bacteria 22083
128 Ga0495615_0000209 3300048090 Bacteria 13612
129 Ga0501036_0016204 3300049572 Bacteria 6224
130 Ga0501037_0001809 3300049573 Bacteria 15533
131 Ga0501038_0257569 3300049574 Bacteria 1380
132 Ga0501041_0032476 3300049577 Unclassified 3155
133 Ga0501043_0019004 3300049579 Bacteria 5394
134 Ga0501046_0646758 3300049580 Bacteria 748
135 Ga0501047_0038378 3300049581 Bacteria 4635
136 Ga0501048_0148289 3300049582 Bacteria 1659
137 Ga0501068_0462625 3300049584 Bacteria 821
138 Ga0501070_0099131 3300049586 Bacteria 2410
139 Ga0501070_0108512 3300049586 Bacteria 2293
140 Ga0501070_0671206 3300049586 Bacteria 821
141 Ga0501079_0127471 3300049741 Unclassified 1980
142 Ga0501080_0139022 3300049742 Bacteria 2246
143 Ga0501081_0154551 3300049743 Bacteria 1650
144 Ga0501083_0031888 3300049744 Bacteria 3615
145 Ga0501282_000022 3300049778 Bacteria 22042
146 Ga0501044_0004453 3300049823 Bacteria 15668
147 Ga0501044_0614193 3300049823 Bacteria 979
148 Ga0501226_000171 3300049853 Bacteria 10924
149 nmdc:mga0yw44_139481_c1 3300050492 Bacteria 1575
150 nmdc:mga06r32_517677_c1 3300050510 Bacteria 1169
151 nmdc:mga06r32_93550_c1 3300050510 Bacteria 2940
152 nmdc:mga08y16_20441_c1 3300050511 Bacteria 6988
153 Ga0500636_0008957 3300053177 Bacteria 5813
154 Ga0501082_0036585 3300060353 Bacteria 4229
155 2643868202 2643221570 Bacteria 5103772
156 2919708373 2919704043 Bacteria 5560311
157 2990196943 2990196909 Bacteria 4054280
158 Ga0316575_10131601
159 JGI25157J39369_1000440
160 rootL2_10239614
161 Ga0065704_10013916
162 Ga0070676_10028350
163 Ga0070683_100080839
164 Ga0070677_10060449
165 Ga0070680_100155618
166 Ga0070689_100871299
167 Ga0070691_10005334
168 Ga0070692_10061607
169 Ga0070668_100145283
170 Ga0070669_100003667
171 Ga0070700_100370989
172 Ga0070662_100001266
173 Ga0070681_10040063
174 Ga0070681_10182600
175 Ga0070679_100027678
176 Ga0070684_100043860
177 Ga0070695_100648491
178 Ga0070665_100221126
179 Ga0070665_100543932
180 Ga0068855_100008525
181 Ga0068855_100276241
182 Ga0068857_100083736
183 Ga0068854_100000737
184 Ga0070702_100155144
185 Ga0068852_100172967
186 Ga0068859_100076448
187 Ga0068866_10216757
188 Ga0068861_100000308
189 Ga0068861_100218661
190 Ga0068851_10036967
191 Ga0068862_100000651
192 Ga0068862_101246459
193 Ga0075428_100523464
194 Ga0075430_100426286
195 Ga0075431_100031137
196 Ga0097620_100076447
197 Ga0079104_1000001
198 Ga0111539_10012557
199 Ga0111539_10294857
200 Ga0105243_10643974
201 Ga0105241_10215237
202 Ga0105238_10008607
203 Ga0105249_10023205
204 Ga0157371_10005271
205 Ga0157371_10118127
206 Ga0157370_10028176
207 Ga0157370_10057348
208 Ga0163162_10342359
209 Ga0213872_10104884
210 Ga0209026_1000139
211 Ga0209759_1002596
212 Ga0207656_10006112
213 Ga0207645_10138172
214 Ga0207707_10006872
215 Ga0207707_10127371
216 Ga0207681_10003217
217 Ga0207694_10009269
218 Ga0207690_10008306
219 Ga0207706_10006581
220 Ga0207670_10779986
221 Ga0207667_10010932
222 Ga0207667_10230884
223 Ga0207712_10010934
224 Ga0207668_10055440
225 Ga0207640_10001329
226 Ga0207658_10656818
227 Ga0207678_10539044
228 Ga0207708_10447513
229 Ga0207674_10097592
230 Ga0207675_100002941
231 Ga0209281_1000151
232 Ga0207428_10095688
233 Ga0268266_10066503
234 Ga0268266_10368080
235 Ga0268265_10000794
236 Ga0268265_11185223
237 Ga0268264_10910779
238 Ga0307416_101551439
239 Ga0307411_10101740
240 Ga0373923_0033246
241 Ga0373937_0093425
242 Ga0316582_0241683
243 Ga0395899_0000003
244 Ga0395899_0001496
245 Ga0395900_0004588
246 Ga0395900_0010309
247 Ga0395898_0004438
248 Ga0395898_0134139
249 Ga0395905_0000469
250 Ga0395901_0005798
251 Ga0395901_0146994
252 Ga0436360_1181565
253 Ga0436361_0132766
254 Ga0436361_0469102
255 Ga0436361_0847483
256 Ga0436361_0922204
257 Ga0439465_0014225
258 Ga0439441_008215
259 Ga0439435_0051196
260 Ga0451577_0069580
261 Ga0451577_0276575
262 Ga0466969_0090561
263 Ga0453683_0003268
264 Ga0466964_0000077
265 Ga0453684_0004871
266 Ga0453684_0070495
267 Ga0453684_0125810
268 Ga0453684_0262579
269 Ga0453684_0710373
270 Ga0466959_0026440
271 Ga0451576_0010904
272 Ga0451576_0077479
273 Ga0451576_0096576
274 Ga0451576_0403490
275 Ga0466958_0496468
276 Ga0495638_0004445
277 Ga0495605_0068976
278 Ga0495663_0003326
279 Ga0495598_0026943
280 Ga0495656_0010565
281 Ga0495625_0001626
282 Ga0495672_0017603
283 Ga0495685_024049
284 Ga0495673_0001179
285 Ga0495615_0000209
286 Ga0501036_0016204
287 Ga0501037_0001809
288 Ga0501038_0257569
289 Ga0501041_0032476
290 Ga0501043_0019004
291 Ga0501046_0646758
292 Ga0501047_0038378
293 Ga0501048_0148289
294 Ga0501068_0462625
295 Ga0501070_0099131
296 Ga0501070_0108512
297 Ga0501070_0671206
298 Ga0501079_0127471
299 Ga0501080_0139022
300 Ga0501081_0154551
301 Ga0501083_0031888
302 Ga0501282_000022
303 Ga0501044_0004453
304 Ga0501044_0614193
305 Ga0501226_000171
306 nmdc:mga0yw44_139481_c1
307 nmdc:mga06r32_517677_c1
308 nmdc:mga06r32_93550_c1
309 nmdc:mga08y16_20441_c1
310 Ga0500636_0008957
311 Ga0501082_0036585
312 2643868202
313 2919708373
314 2990196943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qos-assembly2.cif.gz_B cyclopropane fatty acid synthase from aquifex aeolicous with bound ligands 0.7824 26 205
7qos-assembly1.cif.gz_A cyclopropane fatty acid synthase from aquifex aeolicous with bound ligands 0.7631 26 205
2p7h-assembly1.cif.gz_A crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.85 a resolution 0.7602 25 205
5do0-assembly1.cif.gz_A the structure of pkmt1 from rickettsia prowazekii 0.7568 32 148
1xtp-assembly1.cif.gz_A structural analysis of leishmania major lmaj004091aaa, a sam-dependent methyltransferase of the duf858/pfam05891 family 0.7542 6 203
ID Description Score Start End Superfamily
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8078 38 136 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8016 35 136 3.40.50.150
af_D3Z930_164_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7901 29 147 3.40.50.150
af_A4HTK3_182_475_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7824 26 186 3.40.50.150
af_A0A1D6IAK3_2_136_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7681 24 149 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7D5MIT9-F1-model_v4 Methyltransferase domain-containing protein 0.9942 2 206 GO:0008168
GO:0032259
AF-A0A7Y0DBS8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9848 94 205
AF-A0A7D5MIT9-F1-model_v4 Methyltransferase domain-containing protein 0.9846 2 206 GO:0008168
GO:0032259
AF-A0A2E1NXR6-F1-model_v4 deleted 0.982 2 205
AF-A0A2E1NXR6-F1-model_v4 deleted 0.9772 2 205

Map