F227750

General Info

Members Datasets Scaffolds Average Seq Length
157 107 157 142

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0067418|Ga0373931_0067418_424_939
Length 163
Sequence VRVQGEEEIRGPGSERAETESEIEASEAALMFNPTRDQAREFLFDLWAKHRAGEPLTALESMALAVILEHPEYHAILDDRERYLDRDWKPEGGETNPFLHLQMHLAIEEQVSIDQPPGIRSAVGALARKHDSMDCLAEMVWNAQRHGTGFDNAAYLDCIRRKG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
100 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.27
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10068294 3300005327 Bacteria 2905
2 Ga0070683_100767174 3300005329 Bacteria 924
3 Ga0070690_100688961 3300005330 Bacteria 784
4 Ga0068869_101328385 3300005334 Bacteria 635
5 Ga0070682_101305027 3300005337 Bacteria 617
6 Ga0070687_100657856 3300005343 Bacteria 727
7 Ga0070661_100609743 3300005344 Bacteria 883
8 Ga0070692_10530299 3300005345 Bacteria 768
9 Ga0070674_100205961 3300005356 Bacteria 1522
10 Ga0070674_100403879 3300005356 Bacteria 1117
11 Ga0070673_100373520 3300005364 Bacteria 1270
12 Ga0070673_100738042 3300005364 Bacteria 906
13 Ga0070659_100086103 3300005366 Bacteria 2514
14 Ga0070659_100626622 3300005366 Bacteria 926
15 Ga0070667_101047306 3300005367 Bacteria 762
16 Ga0070714_100083036 3300005435 Bacteria 2792
17 Ga0070710_11175870 3300005437 Bacteria 566
18 Ga0070701_10037958 3300005438 Bacteria 2434
19 Ga0070681_10019263 3300005458 Bacteria 6827
20 Ga0068867_100153009 3300005459 Bacteria 1813
21 Ga0068867_100423636 3300005459 Bacteria 1128
22 Ga0068867_102030271 3300005459 Bacteria 544
23 Ga0070707_100380720 3300005468 Bacteria 1371
24 Ga0070699_100114298 3300005518 Bacteria 2371
25 Ga0070679_100136081 3300005530 Bacteria 2438
26 Ga0070679_100308304 3300005530 Bacteria 1533
27 Ga0070679_100329837 3300005530 Bacteria 1475
28 Ga0070684_100139372 3300005535 Bacteria 2193
29 Ga0068853_100058114 3300005539 Bacteria 3338
30 Ga0068853_100600690 3300005539 Bacteria 1045
31 Ga0070696_100020257 3300005546 Bacteria 4508
32 Ga0070693_101669368 3300005547 Bacteria 502
33 Ga0068855_100010543 3300005563 Bacteria 11146
34 Ga0068855_100016928 3300005563 Bacteria 8766
35 Ga0068855_100137079 3300005563 Bacteria 2791
36 Ga0068855_100762987 3300005563 Bacteria 1031
37 Ga0068854_100540340 3300005578 Bacteria 987
38 Ga0070702_100114203 3300005615 Bacteria 1680
39 Ga0070702_101445137 3300005615 Bacteria 564
40 Ga0068852_100009549 3300005616 Bacteria 7208
41 Ga0068852_100111683 3300005616 Bacteria 2485
42 Ga0068861_100763371 3300005719 Unclassified 904
43 Ga0068851_10393515 3300005834 Bacteria 814
44 Ga0068863_101717099 3300005841 Bacteria 637
45 Ga0068858_100238864 3300005842 Bacteria 1723
46 Ga0068860_100512073 3300005843 Bacteria 1199
47 Ga0081539_10109899 3300005985 Bacteria 1390
48 Ga0070717_10395818 3300006028 Bacteria 1240
49 Ga0075428_100014151 3300006844 Bacteria 8876
50 Ga0075434_100084139 3300006871 Bacteria 3180
51 Ga0075434_100122189 3300006871 Bacteria 2620
52 Ga0075434_100831685 3300006871 Bacteria 939
53 Ga0075436_100015246 3300006914 Bacteria 5263
54 Ga0075435_100376320 3300007076 Bacteria 1219
55 Ga0075435_100419127 3300007076 Bacteria 1153
56 Ga0105240_10081028 3300009093 Bacteria 3990
57 Ga0105240_10255030 3300009093 Bacteria 2026
58 Ga0105240_11249327 3300009093 Bacteria 785
59 Ga0111539_10000744 3300009094 Bacteria 42281
60 Ga0105245_10242434 3300009098 Bacteria 1748
61 Ga0105245_11161768 3300009098 Bacteria 819
62 Ga0105243_10250765 3300009148 Bacteria 1580
63 Ga0105241_10193508 3300009174 Bacteria 1694
64 Ga0105241_10369076 3300009174 Bacteria 1251
65 Ga0105242_10008161 3300009176 Bacteria 8051
66 Ga0105248_10218825 3300009177 Bacteria 2144
67 Ga0105237_10970079 3300009545 Bacteria 857
68 Ga0105238_10005281 3300009551 Bacteria 12773
69 Ga0105238_10088368 3300009551 Bacteria 3085
70 Ga0105238_10188832 3300009551 Bacteria 2037
71 Ga0157371_10991570 3300013102 Bacteria 640
72 Ga0157370_10501322 3300013104 Bacteria 1115
73 Ga0157369_10000908 3300013105 Bacteria 37806
74 Ga0157369_10876399 3300013105 Bacteria 921
75 Ga0157369_11939057 3300013105 Bacteria 598
76 Ga0163162_10957156 3300013306 Bacteria 967
77 Ga0157372_10001580 3300013307 Bacteria 24846
78 Ga0157372_10339605 3300013307 Bacteria 1749
79 Ga0157372_10923097 3300013307 Bacteria 1012
80 Ga0163163_10713830 3300014325 Unclassified 1066
81 Ga0157380_10034339 3300014326 Bacteria 3912
82 Ga0182007_10258463 3300015262 Bacteria 627
83 Ga0207705_10099881 3300025909 Bacteria 2134
84 Ga0207705_10179862 3300025909 Bacteria 1596
85 Ga0207705_10818923 3300025909 Bacteria 722
86 Ga0207654_10116147 3300025911 Bacteria 1673
87 Ga0207695_10018654 3300025913 Bacteria 8014
88 Ga0207695_10122576 3300025913 Bacteria 2566
89 Ga0207695_10184659 3300025913 Bacteria 2005
90 Ga0207662_10120584 3300025918 Bacteria 1645
91 Ga0207694_10048060 3300025924 Bacteria 3301
92 Ga0207694_10560514 3300025924 Bacteria 959
93 Ga0207694_10932200 3300025924 Bacteria 734
94 Ga0207659_10774990 3300025926 Bacteria 823
95 Ga0207664_10053125 3300025929 Bacteria 3206
96 Ga0207690_10301393 3300025932 Bacteria 1254
97 Ga0207690_11285624 3300025932 Bacteria 611
98 Ga0207706_10344260 3300025933 Bacteria 1297
99 Ga0207686_10023283 3300025934 Bacteria 3575
100 Ga0207709_10043506 3300025935 Bacteria 2707
101 Ga0207669_10205166 3300025937 Bacteria 1434
102 Ga0207661_10668991 3300025944 Bacteria 954
103 Ga0207667_10004711 3300025949 Bacteria 16696
104 Ga0207667_10788600 3300025949 Bacteria 948
105 Ga0207651_10232674 3300025960 Bacteria 1497
106 Ga0207640_10259783 3300025981 Bacteria 1353
107 Ga0207677_10249848 3300026023 Bacteria 1440
108 Ga0207703_10028636 3300026035 Bacteria 4393
109 Ga0207639_10258898 3300026041 Bacteria 1521
110 Ga0207639_10880730 3300026041 Bacteria 836
111 Ga0207708_10297471 3300026075 Bacteria 1312
112 Ga0207641_10691466 3300026088 Bacteria 1004
113 Ga0207648_10084239 3300026089 Bacteria 2773
114 Ga0207648_10154155 3300026089 Bacteria 2028
115 Ga0207675_100282666 3300026118 Bacteria 1612
116 Ga0207675_100432070 3300026118 Bacteria 1302
117 Ga0207675_100712585 3300026118 Unclassified 1013
118 Ga0207675_101468487 3300026118 Bacteria 702
119 Ga0207683_10307188 3300026121 Bacteria 1452
120 Ga0207698_10015973 3300026142 Bacteria 5048
121 Ga0207428_10001610 3300027907 Bacteria 23431
122 Ga0265325_10196829 3300031241 Bacteria 932
123 Ga0265339_10132738 3300031249 Bacteria 1272
124 Ga0307408_100132212 3300031548 Bacteria 1948
125 Ga0307408_101477893 3300031548 Bacteria 642
126 Ga0307405_10342536 3300031731 Bacteria 1150
127 Ga0307413_11807307 3300031824 Bacteria 547
128 Ga0307412_10049777 3300031911 Bacteria 2762
129 Ga0307409_100160040 3300031995 Bacteria 1968
130 Ga0307416_100044551 3300032002 Bacteria 3485
131 Ga0307416_100181168 3300032002 Bacteria 1975
132 Ga0307416_100241107 3300032002 Bacteria 1752
133 Ga0307416_101365184 3300032002 Bacteria 814
134 Ga0307411_10138857 3300032005 Bacteria 1789
135 Ga0373944_0104843 3300035089 Bacteria 959
136 Ga0373961_0280408 3300035241 Bacteria 611
137 Ga0373931_0067418 3300035691 Bacteria 1945
138 Ga0373931_0269268 3300035691 Bacteria 1042
139 Ga0373931_0473612 3300035691 Unclassified 804
140 Ga0373925_0011469 3300037068 Bacteria 6414
141 Ga0373925_0728256 3300037068 Bacteria 818
142 Ga0436365_1166113 3300039437 Bacteria 6430
143 Ga0436361_0260382 3300039447 Bacteria 1082
144 Ga0451807_1727868 3300041486 Bacteria 863
145 Ga0439441_021715 3300042001 Bacteria 1187
146 Ga0450898_120579 3300042134 Bacteria 560
147 Ga0495657_0329726 3300046675 Bacteria 906
148 Ga0496112_1407010 3300048915 Bacteria 612
149 nmdc:mga0k408_87723_c1 3300050493 Bacteria 1827
150 nmdc:mga08y16_2273_c1 3300050511 Bacteria 19679
151 nmdc:mga08y16_654462_c1 3300050511 Bacteria 1054
152 nmdc:mga0n895_121564_c1 3300050512 Bacteria 2632
153 nmdc:mga0n895_246739_c1 3300050512 Bacteria 1812
154 nmdc:mga0n895_346218_c1 3300050512 Bacteria 1505
155 nmdc:mga0n895_705927_c1 3300050512 Bacteria 1004
156 nmdc:mga0rr50_435390_c1 3300050513 Bacteria 1110
157 Ga0495595_0661870 3300053084 Bacteria 535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10297471 Ga0207708_102974712 131
2 3300005459 Ga0068867_100153009 Ga0068867_1001530092 133
3 3300005834 Ga0068851_10393515 Ga0068851_103935151 133
4 3300005842 Ga0068858_100238864 Ga0068858_1002388642 133
5 3300009148 Ga0105243_10250765 Ga0105243_102507652 133
6 3300009176 Ga0105242_10008161 Ga0105242_100081612 133
7 3300009177 Ga0105248_10218825 Ga0105248_102188253 133
8 3300013306 Ga0163162_10957156 Ga0163162_109571562 133
9 3300025924 Ga0207694_10560514 Ga0207694_105605142 133
10 3300025934 Ga0207686_10023283 Ga0207686_100232832 133
11 3300025935 Ga0207709_10043506 Ga0207709_100435063 133
12 3300026089 Ga0207648_10084239 Ga0207648_100842393 133
13 3300035691 Ga0373931_0067418 Ga0373931_0067418_424_939 133
14 3300005616 Ga0068852_100111683 Ga0068852_1001116833 134
15 3300039437 Ga0436365_1166113 Ga0436365_1166113_4989_5414 134
16 3300005337 Ga0070682_101305027 Ga0070682_1013050272 135
17 3300005843 Ga0068860_100512073 Ga0068860_1005120732 135
18 3300006871 Ga0075434_100084139 Ga0075434_1000841393 135
19 3300025909 Ga0207705_10818923 Ga0207705_108189232 135
20 3300025981 Ga0207640_10259783 Ga0207640_102597832 135
21 3300032002 Ga0307416_101365184 Ga0307416_1013651842 135
22 3300042134 Ga0450898_120579 Ga0450898_120579_41_469 135
23 3300050512 nmdc:mga0n895_246739_c1 nmdc:mga0n895_246739_c1_1084_1512 135
24 3300005334 Ga0068869_101328385 Ga0068869_1013283852 136
25 3300005356 Ga0070674_100205961 Ga0070674_1002059612 136
26 3300009098 Ga0105245_10242434 Ga0105245_102424342 136
27 3300025937 Ga0207669_10205166 Ga0207669_102051662 136
28 3300026023 Ga0207677_10249848 Ga0207677_102498482 136
29 3300026118 Ga0207675_101468487 Ga0207675_1014684871 136
30 3300026121 Ga0207683_10307188 Ga0207683_103071882 136
31 3300005366 Ga0070659_100626622 Ga0070659_1006266222 140
32 3300005468 Ga0070707_100380720 Ga0070707_1003807202 140
33 3300005518 Ga0070699_100114298 Ga0070699_1001142982 140
34 3300005546 Ga0070696_100020257 Ga0070696_1000202571 140
35 3300026118 Ga0207675_100282666 Ga0207675_1002826662 140
36 3300032002 Ga0307416_100181168 Ga0307416_1001811683 140
37 3300039447 Ga0436361_0260382 Ga0436361_0260382_332_775 140
38 3300050493 nmdc:mga0k408_87723_c1 nmdc:mga0k408_87723_c1_790_1212 140
39 3300005330 Ga0070690_100688961 Ga0070690_1006889612 141
40 3300005435 Ga0070714_100083036 Ga0070714_1000830363 141
41 3300005530 Ga0070679_100329837 Ga0070679_1003298372 141
42 3300005535 Ga0070684_100139372 Ga0070684_1001393723 141
43 3300005563 Ga0068855_100016928 Ga0068855_1000169281 141
44 3300005615 Ga0070702_100114203 Ga0070702_1001142031 141
45 3300005719 Ga0068861_100763371 Ga0068861_1007633712 141
46 3300005985 Ga0081539_10109899 Ga0081539_101098993 141
47 3300006028 Ga0070717_10395818 Ga0070717_103958182 141
48 3300006871 Ga0075434_100122189 Ga0075434_1001221892 141
49 3300006871 Ga0075434_100831685 Ga0075434_1008316852 141
50 3300006914 Ga0075436_100015246 Ga0075436_1000152462 141
51 3300007076 Ga0075435_100376320 Ga0075435_1003763202 141
52 3300009093 Ga0105240_10081028 Ga0105240_100810283 141
53 3300009093 Ga0105240_11249327 Ga0105240_112493272 141
54 3300009174 Ga0105241_10369076 Ga0105241_103690762 141
55 3300009545 Ga0105237_10970079 Ga0105237_109700792 141
56 3300013105 Ga0157369_10876399 Ga0157369_108763992 141
57 3300013105 Ga0157369_11939057 Ga0157369_119390571 141
58 3300025911 Ga0207654_10116147 Ga0207654_101161472 141
59 3300025913 Ga0207695_10018654 Ga0207695_100186547 141
60 3300025929 Ga0207664_10053125 Ga0207664_100531254 141
61 3300025949 Ga0207667_10004711 Ga0207667_100047111 141
62 3300025949 Ga0207667_10788600 Ga0207667_107886002 141
63 3300026118 Ga0207675_100712585 Ga0207675_1007125852 141
64 3300031731 Ga0307405_10342536 Ga0307405_103425362 141
65 3300041486 Ga0451807_1727868 Ga0451807_1727868_276_701 141
66 3300050512 nmdc:mga0n895_121564_c1 nmdc:mga0n895_121564_c1_1849_2277 141
67 3300050512 nmdc:mga0n895_705927_c1 nmdc:mga0n895_705927_c1_296_730 141
68 3300050513 nmdc:mga0rr50_435390_c1 nmdc:mga0rr50_435390_c1_242_670 141
69 3300005327 Ga0070658_10068294 Ga0070658_100682944 142
70 3300005329 Ga0070683_100767174 Ga0070683_1007671742 142
71 3300005343 Ga0070687_100657856 Ga0070687_1006578562 142
72 3300005344 Ga0070661_100609743 Ga0070661_1006097432 142
73 3300005345 Ga0070692_10530299 Ga0070692_105302992 142
74 3300005356 Ga0070674_100403879 Ga0070674_1004038792 142
75 3300005364 Ga0070673_100373520 Ga0070673_1003735202 142
76 3300005364 Ga0070673_100738042 Ga0070673_1007380422 142
77 3300005366 Ga0070659_100086103 Ga0070659_1000861033 142
78 3300005367 Ga0070667_101047306 Ga0070667_1010473061 142
79 3300005437 Ga0070710_11175870 Ga0070710_111758701 142
80 3300005438 Ga0070701_10037958 Ga0070701_100379583 142
81 3300005458 Ga0070681_10019263 Ga0070681_100192631 142
82 3300005459 Ga0068867_100423636 Ga0068867_1004236362 142
83 3300005459 Ga0068867_102030271 Ga0068867_1020302711 142
84 3300005530 Ga0070679_100136081 Ga0070679_1001360811 142
85 3300005530 Ga0070679_100308304 Ga0070679_1003083042 142
86 3300005539 Ga0068853_100058114 Ga0068853_1000581143 142
87 3300005539 Ga0068853_100600690 Ga0068853_1006006902 142
88 3300005547 Ga0070693_101669368 Ga0070693_1016693681 142
89 3300005563 Ga0068855_100010543 Ga0068855_10001054311 142
90 3300005563 Ga0068855_100137079 Ga0068855_1001370793 142
91 3300005563 Ga0068855_100762987 Ga0068855_1007629872 142
92 3300005578 Ga0068854_100540340 Ga0068854_1005403402 142
93 3300005615 Ga0070702_101445137 Ga0070702_1014451371 142
94 3300005616 Ga0068852_100009549 Ga0068852_1000095498 142
95 3300005841 Ga0068863_101717099 Ga0068863_1017170992 142
96 3300006844 Ga0075428_100014151 Ga0075428_1000141518 142
97 3300007076 Ga0075435_100419127 Ga0075435_1004191272 142
98 3300009093 Ga0105240_10255030 Ga0105240_102550303 142
99 3300009094 Ga0111539_10000744 Ga0111539_1000074411 142
100 3300009098 Ga0105245_11161768 Ga0105245_111617682 142
101 3300009174 Ga0105241_10193508 Ga0105241_101935082 142
102 3300009551 Ga0105238_10005281 Ga0105238_100052819 142
103 3300009551 Ga0105238_10088368 Ga0105238_100883682 142
104 3300009551 Ga0105238_10188832 Ga0105238_101888322 142
105 3300013102 Ga0157371_10991570 Ga0157371_109915701 142
106 3300013104 Ga0157370_10501322 Ga0157370_105013221 142
107 3300013105 Ga0157369_10000908 Ga0157369_1000090823 142
108 3300013307 Ga0157372_10001580 Ga0157372_1000158023 142
109 3300013307 Ga0157372_10339605 Ga0157372_103396051 142
110 3300013307 Ga0157372_10923097 Ga0157372_109230972 142
111 3300014325 Ga0163163_10713830 Ga0163163_107138302 142
112 3300014326 Ga0157380_10034339 Ga0157380_100343394 142
113 3300015262 Ga0182007_10258463 Ga0182007_102584631 142
114 3300025909 Ga0207705_10099881 Ga0207705_100998812 142
115 3300025909 Ga0207705_10179862 Ga0207705_101798622 142
116 3300025913 Ga0207695_10122576 Ga0207695_101225763 142
117 3300025913 Ga0207695_10184659 Ga0207695_101846592 142
118 3300025918 Ga0207662_10120584 Ga0207662_101205842 142
119 3300025924 Ga0207694_10048060 Ga0207694_100480602 142
120 3300025924 Ga0207694_10932200 Ga0207694_109322002 142
121 3300025926 Ga0207659_10774990 Ga0207659_107749901 142
122 3300025932 Ga0207690_10301393 Ga0207690_103013932 142
123 3300025932 Ga0207690_11285624 Ga0207690_112856241 142
124 3300025933 Ga0207706_10344260 Ga0207706_103442602 142
125 3300025944 Ga0207661_10668991 Ga0207661_106689912 142
126 3300025960 Ga0207651_10232674 Ga0207651_102326742 142
127 3300026035 Ga0207703_10028636 Ga0207703_100286362 142
128 3300026041 Ga0207639_10258898 Ga0207639_102588983 142
129 3300026041 Ga0207639_10880730 Ga0207639_108807302 142
130 3300026088 Ga0207641_10691466 Ga0207641_106914662 142
131 3300026089 Ga0207648_10154155 Ga0207648_101541554 142
132 3300026118 Ga0207675_100432070 Ga0207675_1004320702 142
133 3300026142 Ga0207698_10015973 Ga0207698_100159735 142
134 3300027907 Ga0207428_10001610 Ga0207428_100016105 142
135 3300031241 Ga0265325_10196829 Ga0265325_101968292 142
136 3300031249 Ga0265339_10132738 Ga0265339_101327382 142
137 3300031548 Ga0307408_100132212 Ga0307408_1001322122 142
138 3300031548 Ga0307408_101477893 Ga0307408_1014778931 142
139 3300031824 Ga0307413_11807307 Ga0307413_118073071 142
140 3300031911 Ga0307412_10049777 Ga0307412_100497772 142
141 3300031995 Ga0307409_100160040 Ga0307409_1001600404 142
142 3300032002 Ga0307416_100044551 Ga0307416_1000445513 142
143 3300032002 Ga0307416_100241107 Ga0307416_1002411072 142
144 3300032005 Ga0307411_10138857 Ga0307411_101388574 142
145 3300035089 Ga0373944_0104843 Ga0373944_0104843_56_496 142
146 3300035241 Ga0373961_0280408 Ga0373961_0280408_107_535 142
147 3300035691 Ga0373931_0269268 Ga0373931_0269268_544_978 142
148 3300035691 Ga0373931_0473612 Ga0373931_0473612_13_441 142
149 3300037068 Ga0373925_0011469 Ga0373925_0011469_2702_3142 142
150 3300037068 Ga0373925_0728256 Ga0373925_0728256_349_795 142
151 3300042001 Ga0439441_021715 Ga0439441_021715_441_878 142
152 3300046675 Ga0495657_0329726 Ga0495657_0329726_248_682 142
153 3300048915 Ga0496112_1407010 Ga0496112_1407010_102_530 142
154 3300050511 nmdc:mga08y16_2273_c1 nmdc:mga08y16_2273_c1_7445_7873 142
155 3300050511 nmdc:mga08y16_654462_c1 nmdc:mga08y16_654462_c1_13_444 142
156 3300050512 nmdc:mga0n895_346218_c1 nmdc:mga0n895_346218_c1_402_836 142
157 3300053084 Ga0495595_0661870 Ga0495595_0661870_11_445 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08897

DUF1841

Domain of unknown function (DUF1841)

35

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jd9-assembly7.cif.gz_G contact pathway inhibitor from a sand fly 0.6892 87 137
4jd9-assembly4.cif.gz_D contact pathway inhibitor from a sand fly 0.3961 33 137
4jd9-assembly7.cif.gz_G contact pathway inhibitor from a sand fly 0.3248 87 137
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.3171 6 65
4jd9-assembly4.cif.gz_D contact pathway inhibitor from a sand fly 0.3091 33 137
ID Description Score Start End Superfamily
af_G5EE13_764_940_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4404 57 137 1.20.1640.10
3bh1D02 Mainly Alpha;Up-down Bundle;dip2346 fold;dip2346 domain like 0.4345 102 141 1.20.1570.10
af_Q09934_632_831_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3642 33 137 1.20.1640.10
af_F4I9G5_1046_1243_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3569 38 137 1.20.1640.10
af_Q09614_1146_1339_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3544 45 137 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A378KXV7-F1-model_v4 Domain of uncharacterized function (DUF1841) 0.9741 13 142
AF-A0A171JX16-F1-model_v4 deleted 0.9698 77 141
AF-I7IAR2-F1-model_v4 DUF1841 domain-containing protein 0.9694 1 142
AF-A0A4Q6BB78-F1-model_v4 DUF1841 family protein 0.9686 86 139
AF-A0A5C7P8H1-F1-model_v4 DUF1841 family protein 0.9684 33 141

Feature Viewer

pLDDT pTM Quality
92.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map