F228047

General Info

Members Datasets Scaffolds Average Seq Length
157 122 314 150

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0155292|Ga0495596_0155292_287_832
Length 181
Sequence MLEMSKAKETKRGWPRPGSWLAGEVGRTDPGSEAWSLMHWMMVTNKQRLVAMAQEFELAPQQMIALRMLGAGPRKMSDLANALFCDNSNVTGIVDRLEERGLVRREAAEGDRRVKLLVLTDEGERMRIEITKRMAEPPAPIASLSEEDQRTLRDILKRALDSLSEAEVADAVAGKAQAGAQ

Samples

Sample ID Description Type Environment
1 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 12.1
Rhizosphere 84.71
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495596_0155292 3300046500 Bacteria 889
2 Ga0070683_100013143 3300005329 Bacteria 7208
3 Ga0070683_100071830 3300005329 Unclassified 3230
4 Ga0070677_10000003 3300005333 Bacteria 81204
5 Ga0070682_100000102 3300005337 Bacteria 76457
6 Ga0070691_10000054 3300005341 Bacteria 32149
7 Ga0070661_100000005 3300005344 Bacteria 220455
8 Ga0070668_100343874 3300005347 Bacteria 1261
9 Ga0070668_100727541 3300005347 Unclassified 877
10 Ga0070688_100000333 3300005365 Bacteria 24059
11 Ga0070688_100005500 3300005365 Bacteria 6680
12 Ga0070703_10265723 3300005406 Unclassified 702
13 Ga0070663_100138863 3300005455 Unclassified 1853
14 Ga0070681_10005901 3300005458 Bacteria 11857
15 Ga0070685_10000293 3300005466 Bacteria 31562
16 Ga0070685_10003954 3300005466 Bacteria 7487
17 Ga0070679_100000537 3300005530 Bacteria 32232
18 Ga0070684_100005205 3300005535 Bacteria 9946
19 Ga0070684_100091643 3300005535 Bacteria 2704
20 Ga0068853_100243759 3300005539 Bacteria 1648
21 Ga0068853_100631928 3300005539 Bacteria 1018
22 Ga0070695_100118761 3300005545 Bacteria 1806
23 Ga0070665_100000159 3300005548 Bacteria 122613
24 Ga0068854_100001335 3300005578 Bacteria 14874
25 Ga0068854_100087289 3300005578 Unclassified 2314
26 Ga0068856_100051131 3300005614 Bacteria 4075
27 Ga0068852_100033460 3300005616 Bacteria 4268
28 Ga0068861_102077556 3300005719 Bacteria 568
29 Ga0068851_10004367 3300005834 Bacteria 6365
30 Ga0068858_100000043 3300005842 Bacteria 132444
31 Ga0068858_100000049 3300005842 Bacteria 122693
32 Ga0068858_100599948 3300005842 Bacteria 1068
33 Ga0081455_10016007 3300005937 Bacteria 7256
34 Ga0075364_10364866 3300006051 Bacteria 985
35 Ga0075431_100561475 3300006847 Bacteria 1128
36 Ga0075433_10155791 3300006852 Bacteria 2032
37 Ga0075434_100135132 3300006871 Bacteria 2485
38 Ga0111539_10951252 3300009094 Unclassified 999
39 Ga0105245_10000290 3300009098 Bacteria 47991
40 Ga0105245_10001677 3300009098 Bacteria 20157
41 Ga0105245_10003691 3300009098 Bacteria 13667
42 Ga0105243_10099187 3300009148 Bacteria 2414
43 Ga0105242_10061053 3300009176 Bacteria 3099
44 Ga0105242_10127960 3300009176 Unclassified 2188
45 Ga0105249_10000073 3300009553 Bacteria 145660
46 Ga0105249_10739246 3300009553 Bacteria 1046
47 Ga0105249_11601596 3300009553 Bacteria 724
48 Ga0157369_10000099 3300013105 Bacteria 120032
49 Ga0157374_10001500 3300013296 Bacteria 19673
50 Ga0163162_12407947 3300013306 Unclassified 605
51 Ga0157372_10026370 3300013307 Bacteria 6324
52 Ga0157375_10032670 3300013308 Bacteria 4937
53 Ga0157375_11041189 3300013308 Bacteria 956
54 Ga0157380_11892729 3300014326 Bacteria 657
55 Ga0157379_10273782 3300014968 Bacteria 1535
56 Ga0206356_11503659 3300020070 Bacteria 1847
57 Ga0207656_10002305 3300025321 Bacteria 6410
58 Ga0207682_10000052 3300025893 Bacteria 49191
59 Ga0207707_10108986 3300025912 Unclassified 2421
60 Ga0207649_10000005 3300025920 Bacteria 356179
61 Ga0207652_10000631 3300025921 Bacteria 34868
62 Ga0207687_10000012 3300025927 Bacteria 370729
63 Ga0207687_10000646 3300025927 Bacteria 23464
64 Ga0207687_10035866 3300025927 Bacteria 3376
65 Ga0207686_10006424 3300025934 Bacteria 6327
66 Ga0207686_10409039 3300025934 Bacteria 1035
67 Ga0207709_10049455 3300025935 Bacteria 2566
68 Ga0207661_10008416 3300025944 Bacteria 7373
69 Ga0207661_11570141 3300025944 Unclassified 602
70 Ga0207712_10000003 3300025961 Bacteria 615314
71 Ga0207712_10351527 3300025961 Bacteria 1225
72 Ga0207668_10281263 3300025972 Bacteria 1364
73 Ga0207668_10361631 3300025972 Bacteria 1216
74 Ga0207640_10000285 3300025981 Bacteria 33957
75 Ga0207640_10071152 3300025981 Unclassified 2342
76 Ga0207703_10000053 3300026035 Bacteria 143924
77 Ga0207703_10000067 3300026035 Bacteria 125623
78 Ga0207703_10477924 3300026035 Bacteria 1167
79 Ga0207639_10001160 3300026041 Bacteria 17875
80 Ga0207702_10016146 3300026078 Bacteria 6181
81 Ga0207641_10008529 3300026088 Bacteria 8466
82 Ga0207698_10024058 3300026142 Bacteria 4268
83 Ga0268266_10000023 3300028379 Bacteria 501899
84 Ga0268266_11315050 3300028379 Bacteria 698
85 Ga0395900_0285527 3300037418 Bacteria 1641
86 Ga0395898_0059751 3300037466 Bacteria 3707
87 Ga0395898_0269856 3300037466 Bacteria 1623
88 Ga0395898_0513664 3300037466 Bacteria 1139
89 Ga0395905_0188283 3300037471 Bacteria 1937
90 Ga0395901_0340084 3300038443 Bacteria 1551
91 Ga0395901_0762295 3300038443 Bacteria 960
92 Ga0451853_0978943 3300041512 Bacteria 2673
93 Ga0439450_042757 3300042008 Bacteria 1057
94 Ga0466965_0226630 3300044683 Bacteria 997
95 Ga0466963_0000070 3300044694 Bacteria 35676
96 Ga0466967_0000046 3300045976 Bacteria 43911
97 Ga0495629_0032469 3300046459 Bacteria 3696
98 Ga0495638_0076143 3300046460 Bacteria 2044
99 Ga0495641_0015104 3300046461 Bacteria 4144
100 Ga0495662_0024365 3300046476 Bacteria 2920
101 Ga0495594_0000013 3300046499 Bacteria 103201
102 Ga0495608_0478769 3300046511 Bacteria 755
103 Ga0495620_0000315 3300046515 Bacteria 34463
104 Ga0495630_0068839 3300046517 Bacteria 2662
105 Ga0495640_0041629 3300046533 Bacteria 3209
106 Ga0495587_0001970 3300046536 Bacteria 13697
107 Ga0495645_0123040 3300046543 Bacteria 1825
108 Ga0495622_0000014 3300046557 Bacteria 182142
109 Ga0495635_0118310 3300046663 Bacteria 1808
110 Ga0495657_0498786 3300046675 Unclassified 710
111 Ga0495599_0031412 3300046678 Bacteria 3333
112 Ga0495647_0000037 3300046681 Bacteria 42482
113 Ga0495647_0082990 3300046681 Unclassified 1302
114 Ga0495669_0000131 3300046684 Bacteria 47864
115 Ga0495670_0152803 3300046691 Bacteria 1211
116 Ga0495649_0015920 3300046694 Bacteria 4271
117 Ga0495674_0000042 3300047319 Bacteria 94820
118 Ga0495676_0000809 3300047321 Bacteria 26167
119 Ga0495680_0000421 3300047322 Bacteria 47432
120 Ga0495679_011414 3300047446 Bacteria 3429
121 Ga0496100_0000116 3300048903 Bacteria 45781
122 Ga0496101_0000003 3300048904 Bacteria 406565
123 Ga0496102_0023784 3300048905 Bacteria 5444
124 Ga0496103_0326017 3300048906 Bacteria 988
125 Ga0496104_0000003 3300048907 Bacteria 669219
126 Ga0496105_0000008 3300048908 Bacteria 335652
127 Ga0496106_0000177 3300048909 Bacteria 45808
128 Ga0496107_0000081 3300048910 Bacteria 45824
129 Ga0496108_0000002 3300048911 Bacteria 700890
130 Ga0496108_0000045 3300048911 Bacteria 137416
131 Ga0496109_0000001 3300048912 Bacteria 700852
132 Ga0496109_0000032 3300048912 Bacteria 162984
133 Ga0496109_0442798 3300048912 Bacteria 1227
134 Ga0496110_0000033 3300048913 Bacteria 65539
135 Ga0496110_0017994 3300048913 Bacteria 5919
136 Ga0496111_0000125 3300048914 Bacteria 33642
137 Ga0496111_0268644 3300048914 Bacteria 1265
138 Ga0496113_0253914 3300048916 Bacteria 1404
139 Ga0496115_1053335 3300048918 Bacteria 619
140 Ga0501031_0324151 3300049568 Bacteria 998
141 Ga0501040_0463883 3300049576 Unclassified 912
142 Ga0501068_0186679 3300049584 Unclassified 1312
143 Ga0501076_0624703 3300049592 Bacteria 889
144 Ga0501077_0319829 3300049593 Unclassified 989
145 Ga0501079_0274345 3300049741 Bacteria 1318
146 Ga0501045_0173364 3300049824 Unclassified 1607
147 nmdc:mga00v17_171931_c1 3300050491 Bacteria 949
148 nmdc:mga06r32_141727_c1 3300050510 Bacteria 2380
149 nmdc:mga0n895_495875_c1 3300050512 Unclassified 1231
150 nmdc:mga0a205_42090_c1 3300050515 Bacteria 4400
151 Ga0495601_0000086 3300053077 Bacteria 50421
152 Ga0495601_0090352 3300053077 Bacteria 1970
153 Ga0495612_0001304 3300053078 Bacteria 10293
154 Ga0495619_0000022 3300053085 Bacteria 184144
155 Ga0500566_0005120 3300053094 Bacteria 7815
156 Ga0500614_048518 3300053123 Bacteria 1106
157 Ga0501082_0588945 3300060353 Bacteria 973
158 Ga0495596_0155292
159 Ga0070683_100013143
160 Ga0070683_100071830
161 Ga0070677_10000003
162 Ga0070682_100000102
163 Ga0070691_10000054
164 Ga0070661_100000005
165 Ga0070668_100343874
166 Ga0070668_100727541
167 Ga0070688_100000333
168 Ga0070688_100005500
169 Ga0070703_10265723
170 Ga0070663_100138863
171 Ga0070681_10005901
172 Ga0070685_10000293
173 Ga0070685_10003954
174 Ga0070679_100000537
175 Ga0070684_100005205
176 Ga0070684_100091643
177 Ga0068853_100243759
178 Ga0068853_100631928
179 Ga0070695_100118761
180 Ga0070665_100000159
181 Ga0068854_100001335
182 Ga0068854_100087289
183 Ga0068856_100051131
184 Ga0068852_100033460
185 Ga0068861_102077556
186 Ga0068851_10004367
187 Ga0068858_100000043
188 Ga0068858_100000049
189 Ga0068858_100599948
190 Ga0081455_10016007
191 Ga0075364_10364866
192 Ga0075431_100561475
193 Ga0075433_10155791
194 Ga0075434_100135132
195 Ga0111539_10951252
196 Ga0105245_10000290
197 Ga0105245_10001677
198 Ga0105245_10003691
199 Ga0105243_10099187
200 Ga0105242_10061053
201 Ga0105242_10127960
202 Ga0105249_10000073
203 Ga0105249_10739246
204 Ga0105249_11601596
205 Ga0157369_10000099
206 Ga0157374_10001500
207 Ga0163162_12407947
208 Ga0157372_10026370
209 Ga0157375_10032670
210 Ga0157375_11041189
211 Ga0157380_11892729
212 Ga0157379_10273782
213 Ga0206356_11503659
214 Ga0207656_10002305
215 Ga0207682_10000052
216 Ga0207707_10108986
217 Ga0207649_10000005
218 Ga0207652_10000631
219 Ga0207687_10000012
220 Ga0207687_10000646
221 Ga0207687_10035866
222 Ga0207686_10006424
223 Ga0207686_10409039
224 Ga0207709_10049455
225 Ga0207661_10008416
226 Ga0207661_11570141
227 Ga0207712_10000003
228 Ga0207712_10351527
229 Ga0207668_10281263
230 Ga0207668_10361631
231 Ga0207640_10000285
232 Ga0207640_10071152
233 Ga0207703_10000053
234 Ga0207703_10000067
235 Ga0207703_10477924
236 Ga0207639_10001160
237 Ga0207702_10016146
238 Ga0207641_10008529
239 Ga0207698_10024058
240 Ga0268266_10000023
241 Ga0268266_11315050
242 Ga0395900_0285527
243 Ga0395898_0059751
244 Ga0395898_0269856
245 Ga0395898_0513664
246 Ga0395905_0188283
247 Ga0395901_0340084
248 Ga0395901_0762295
249 Ga0451853_0978943
250 Ga0439450_042757
251 Ga0466965_0226630
252 Ga0466963_0000070
253 Ga0466967_0000046
254 Ga0495629_0032469
255 Ga0495638_0076143
256 Ga0495641_0015104
257 Ga0495662_0024365
258 Ga0495594_0000013
259 Ga0495608_0478769
260 Ga0495620_0000315
261 Ga0495630_0068839
262 Ga0495640_0041629
263 Ga0495587_0001970
264 Ga0495645_0123040
265 Ga0495622_0000014
266 Ga0495635_0118310
267 Ga0495657_0498786
268 Ga0495599_0031412
269 Ga0495647_0000037
270 Ga0495647_0082990
271 Ga0495669_0000131
272 Ga0495670_0152803
273 Ga0495649_0015920
274 Ga0495674_0000042
275 Ga0495676_0000809
276 Ga0495680_0000421
277 Ga0495679_011414
278 Ga0496100_0000116
279 Ga0496101_0000003
280 Ga0496102_0023784
281 Ga0496103_0326017
282 Ga0496104_0000003
283 Ga0496105_0000008
284 Ga0496106_0000177
285 Ga0496107_0000081
286 Ga0496108_0000002
287 Ga0496108_0000045
288 Ga0496109_0000001
289 Ga0496109_0000032
290 Ga0496109_0442798
291 Ga0496110_0000033
292 Ga0496110_0017994
293 Ga0496111_0000125
294 Ga0496111_0268644
295 Ga0496113_0253914
296 Ga0496115_1053335
297 Ga0501031_0324151
298 Ga0501040_0463883
299 Ga0501068_0186679
300 Ga0501076_0624703
301 Ga0501077_0319829
302 Ga0501079_0274345
303 Ga0501045_0173364
304 nmdc:mga00v17_171931_c1
305 nmdc:mga06r32_141727_c1
306 nmdc:mga0n895_495875_c1
307 nmdc:mga0a205_42090_c1
308 Ga0495601_0000086
309 Ga0495601_0090352
310 Ga0495612_0001304
311 Ga0495619_0000022
312 Ga0500566_0005120
313 Ga0500614_048518
314 Ga0501082_0588945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

56

114

0.97

PF13463

HTH_27

Winged helix DNA-binding domain

58

123

0.96

PF01047

MarR

MarR family

58

115

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9087 47 105
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9058 47 89
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9039 48 105
2p8t-assembly1.cif.gz_A hypothetical protein ph0730 from pyrococcus horikoshii ot3 0.9036 47 117
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9032 48 104
ID Description Score Start End Superfamily
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9383 47 86 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.928 47 104 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9236 44 103 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.921 49 113 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9154 45 104 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2H6H669-F1-model_v4 Putative HTH-type transcriptional regulator YusO 0.9238 35 145 GO:0003700
GO:0006950
AF-A0A7Y5L1S3-F1-model_v4 MarR family transcriptional regulator 0.9237 40 146 GO:0003700
GO:0006950
AF-A0A5B1BPY1-F1-model_v4 MarR family transcriptional regulator 0.9099 34 120 GO:0003677
GO:0003700
GO:0006950
AF-D5MRJ8-F1-model_v4 Putative transcriptional regulator 0.899 34 144 GO:0003700
GO:0006950
AF-A0A066U3C7-F1-model_v4 HTH marR-type domain-containing protein 0.8988 35 145 GO:0003700
GO:0006950

Map