F228428

General Info

Members Datasets Scaffolds Average Seq Length
157 118 155 150

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_005021|Ga0500595_005021_3454_3948
Length 164
Sequence MTSEIRHAGLIALRLGGFWRGVLIEGPSGVGKSDLALRALDAGFQLVADDRTLVFLSGGRLYGRAPGPLSGLIECRGLGIMGAPSLPFAQIALVLHCEAVPEAVDRMPEPTVQTVLGQPAPLLRLWPFEASAPAKLRRALEVLGRSAQEAYQATLAPPRRRLGA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2643221583 Caulobacter sp. Root655 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
81 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
82 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
114 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.38
Nodule 0
Rhizoplane 4.46
Rhizosphere 75.8
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10131028 3300003316 Bacteria 1112
2 Ga0055526_1073369 3300003771 Bacteria 687
3 Ga0065165_1001140 3300005262 Bacteria 31153
4 Ga0070658_10138574 3300005327 Bacteria 2031
5 Ga0070670_100052577 3300005331 Bacteria 3498
6 Ga0070666_10527168 3300005335 Bacteria 858
7 Ga0070660_101563578 3300005339 Bacteria 561
8 Ga0070668_100002879 3300005347 Bacteria 12697
9 Ga0070668_100079645 3300005347 Bacteria 2565
10 Ga0070668_100110192 3300005347 Bacteria 2190
11 Ga0070668_100193945 3300005347 Bacteria 1665
12 Ga0070669_101897237 3300005353 Bacteria 520
13 Ga0070671_100028714 3300005355 Bacteria 4583
14 Ga0070673_100032309 3300005364 Bacteria 3939
15 Ga0070667_100602913 3300005367 Bacteria 1012
16 Ga0070667_101287792 3300005367 Bacteria 685
17 Ga0070678_100116440 3300005456 Bacteria 2100
18 Ga0070679_100705353 3300005530 Bacteria 952
19 Ga0070665_100000667 3300005548 Bacteria 46192
20 Ga0068859_100053626 3300005617 Bacteria 4056
21 Ga0068864_100056735 3300005618 Bacteria 3383
22 Ga0068864_100687421 3300005618 Bacteria 999
23 Ga0068861_100074078 3300005719 Bacteria 2647
24 Ga0068863_100057940 3300005841 Bacteria 3666
25 Ga0068863_100789726 3300005841 Bacteria 947
26 Ga0068860_100007586 3300005843 Bacteria 10857
27 Ga0068860_100049562 3300005843 Bacteria 3999
28 Ga0068860_100121412 3300005843 Bacteria 2502
29 Ga0068862_100046002 3300005844 Bacteria 3725
30 Ga0068862_100536315 3300005844 Bacteria 1115
31 Ga0070717_10023828 3300006028 Bacteria 4855
32 Ga0075366_10283418 3300006195 Bacteria 1013
33 Ga0075366_10864665 3300006195 Bacteria 563
34 Ga0068871_100496038 3300006358 Bacteria 1100
35 Ga0068865_100514355 3300006881 Bacteria 1000
36 Ga0097620_100053624 3300006931 Bacteria 4056
37 Ga0105241_10059163 3300009174 Bacteria 2945
38 Ga0105248_10010627 3300009177 Bacteria 10150
39 Ga0105248_10041237 3300009177 Bacteria 5174
40 Ga0105248_10336442 3300009177 Bacteria 1700
41 Ga0105238_10080642 3300009551 Bacteria 3244
42 Ga0105238_11200015 3300009551 Bacteria 783
43 Ga0105249_10258718 3300009553 Bacteria 1728
44 Ga0105249_11070061 3300009553 Bacteria 876
45 Ga0105239_11183615 3300010375 Bacteria 881
46 Ga0163162_10158089 3300013306 Bacteria 2387
47 Ga0157375_10036322 3300013308 Bacteria 4713
48 Ga0163163_10063277 3300014325 Bacteria 3668
49 Ga0163163_10073321 3300014325 Bacteria 3414
50 Ga0157380_10073811 3300014326 Bacteria 2767
51 Ga0209148_1010189 3300025254 Bacteria 1794
52 Ga0209564_1001621 3300025295 Bacteria 21837
53 Ga0209564_1031698 3300025295 Bacteria 1609
54 Ga0207680_10132774 3300025903 Bacteria 1642
55 Ga0207680_10355444 3300025903 Bacteria 1030
56 Ga0207705_10293291 3300025909 Bacteria 1246
57 Ga0207654_10910812 3300025911 Bacteria 638
58 Ga0207695_10001997 3300025913 Bacteria 31506
59 Ga0207695_10127566 3300025913 Bacteria 2505
60 Ga0207652_10134163 3300025921 Bacteria 2210
61 Ga0207681_10300922 3300025923 Bacteria 1269
62 Ga0207694_10222501 3300025924 Bacteria 1540
63 Ga0207650_10155644 3300025925 Bacteria 1807
64 Ga0207644_10063547 3300025931 Bacteria 2680
65 Ga0207711_10001176 3300025941 Bacteria 24900
66 Ga0207711_10051504 3300025941 Bacteria 3526
67 Ga0207711_10063721 3300025941 Bacteria 3183
68 Ga0207661_10444759 3300025944 Bacteria 1180
69 Ga0207679_10058189 3300025945 Bacteria 2862
70 Ga0207667_10904232 3300025949 Bacteria 874
71 Ga0207651_10029720 3300025960 Bacteria 3468
72 Ga0207712_10195048 3300025961 Bacteria 1601
73 Ga0207668_10000004 3300025972 Bacteria 201204
74 Ga0207668_10003898 3300025972 Bacteria 8790
75 Ga0207668_10118062 3300025972 Bacteria 2003
76 Ga0207658_10096515 3300025986 Bacteria 2305
77 Ga0207658_10517655 3300025986 Bacteria 1064
78 Ga0207658_10588890 3300025986 Bacteria 998
79 Ga0207658_10702385 3300025986 Bacteria 914
80 Ga0207677_10102421 3300026023 Bacteria 2111
81 Ga0207703_10461059 3300026035 Bacteria 1188
82 Ga0207639_10088921 3300026041 Bacteria 2467
83 Ga0207678_10585310 3300026067 Bacteria 978
84 Ga0207641_10060475 3300026088 Bacteria 3229
85 Ga0207641_10063398 3300026088 Bacteria 3157
86 Ga0207641_10096960 3300026088 Bacteria 2591
87 Ga0207676_10044408 3300026095 Bacteria 3428
88 Ga0207676_10277385 3300026095 Bacteria 1520
89 Ga0207675_100088067 3300026118 Bacteria 2916
90 Ga0207683_10176932 3300026121 Bacteria 1934
91 Ga0209999_1006174 3300027543 Bacteria 2152
92 Ga0209983_1014266 3300027665 Bacteria 1637
93 Ga0209974_10156134 3300027876 Bacteria 826
94 Ga0268266_10000970 3300028379 Bacteria 36427
95 Ga0268265_10001167 3300028380 Bacteria 23017
96 Ga0268265_10064875 3300028380 Bacteria 2815
97 Ga0268264_10000091 3300028381 Bacteria 233338
98 Ga0268264_10061776 3300028381 Bacteria 3144
99 Ga0268264_10100817 3300028381 Bacteria 2509
100 Ga0307517_10003229 3300028786 Bacteria 25559
101 Ga0307513_10004517 3300031456 Bacteria 18553
102 Ga0307508_10355239 3300031616 Bacteria 1057
103 Ga0307516_10001321 3300031730 Bacteria 34374
104 Ga0307510_10004465 3300033180 Bacteria 16455
105 Ga0395905_0208309 3300037471 Bacteria 1832
106 Ga0395901_0278854 3300038443 Bacteria 1737
107 Ga0436365_0349879 3300039437 Bacteria 630
108 Ga0439465_0084929 3300041413 Bacteria 1077
109 Ga0439446_0040802 3300042156 Bacteria 1366
110 Ga0439435_0129360 3300042436 Bacteria 796
111 Ga0439459_0008077 3300042438 Bacteria 1791
112 Ga0495627_000513 3300046453 Bacteria 32122
113 Ga0495584_0651446 3300046491 Unclassified 537
114 Ga0495583_0000399 3300046506 Bacteria 66020
115 Ga0495597_0038686 3300046542 Bacteria 2137
116 Ga0495625_0005971 3300046660 Bacteria 10945
117 Ga0495625_0131383 3300046660 Bacteria 1696
118 Ga0495669_0000006 3300046684 Bacteria 190838
119 Ga0495589_0011506 3300046794 Bacteria 4594
120 Ga0495660_0030687 3300046810 Bacteria 3027
121 Ga0495660_0158920 3300046810 Bacteria 1110
122 Ga0495636_0034651 3300047318 Bacteria 2078
123 Ga0495677_0010022 3300047445 Bacteria 3487
124 Ga0495679_005578 3300047446 Bacteria 5552
125 Ga0496102_0043292 3300048905 Bacteria 4082
126 Ga0496104_0379372 3300048907 Bacteria 1326
127 Ga0496106_0388195 3300048909 Bacteria 1122
128 Ga0496108_0049118 3300048911 Bacteria 3529
129 Ga0496112_0097568 3300048915 Bacteria 2909
130 Ga0496115_0001441 3300048918 Bacteria 17034
131 Ga0496115_0201308 3300048918 Bacteria 1645
132 Ga0496124_0018893 3300048927 Bacteria 6435
133 Ga0496126_0254011 3300048929 Bacteria 1464
134 Ga0501034_0381249 3300049571 Bacteria 1335
135 Ga0501034_0534574 3300049571 Bacteria 1083
136 Ga0501047_0086708 3300049581 Bacteria 3008
137 Ga0501047_1183816 3300049581 Bacteria 578
138 Ga0501048_0101125 3300049582 Bacteria 2034
139 Ga0501069_0972943 3300049585 Bacteria 518
140 Ga0501257_113824 3300049686 Bacteria 719
141 Ga0501035_0900475 3300049822 Bacteria 701
142 nmdc:mga0k408_58505_c1 3300050493 Bacteria 2238
143 nmdc:mga04h51_461693_c1 3300050495 Bacteria 538
144 nmdc:mga0sz30_4463_c1 3300050516 Bacteria 3023
145 Ga0500643_007002 3300053087 Bacteria 4625
146 Ga0500643_045675 3300053087 Bacteria 1268
147 Ga0500562_000903 3300053108 Bacteria 7198
148 Ga0500595_005021 3300053119 Bacteria 5828
149 Ga0500618_000152 3300053125 Bacteria 57055
150 Ga0500559_0000054 3300053136 Bacteria 90695
151 Ga0500559_0009580 3300053136 Bacteria 4184
152 Ga0500559_0021269 3300053136 Bacteria 2748
153 Ga0500577_0041536 3300053142 Bacteria 1678
154 Ga0500616_0026684 3300053153 Bacteria 3195
155 Ga0500622_0074464 3300053156 Bacteria 1710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10300922 Ga0207681_103009222 132
2 3300006195 Ga0075366_10864665 Ga0075366_108646651 134
3 3300005327 Ga0070658_10138574 Ga0070658_101385742 140
4 3300005331 Ga0070670_100052577 Ga0070670_1000525773 140
5 3300005335 Ga0070666_10527168 Ga0070666_105271682 140
6 3300005339 Ga0070660_101563578 Ga0070660_1015635781 140
7 3300005347 Ga0070668_100002879 Ga0070668_1000028795 140
8 3300005347 Ga0070668_100079645 Ga0070668_1000796453 140
9 3300005347 Ga0070668_100110192 Ga0070668_1001101923 140
10 3300005347 Ga0070668_100193945 Ga0070668_1001939454 140
11 3300005355 Ga0070671_100028714 Ga0070671_1000287144 140
12 3300005364 Ga0070673_100032309 Ga0070673_1000323095 140
13 3300005367 Ga0070667_100602913 Ga0070667_1006029132 140
14 3300005367 Ga0070667_101287792 Ga0070667_1012877921 140
15 3300005456 Ga0070678_100116440 Ga0070678_1001164402 140
16 3300005530 Ga0070679_100705353 Ga0070679_1007053532 140
17 3300005548 Ga0070665_100000667 Ga0070665_10000066749 140
18 3300005617 Ga0068859_100053626 Ga0068859_1000536265 140
19 3300005618 Ga0068864_100056735 Ga0068864_1000567353 140
20 3300005618 Ga0068864_100687421 Ga0068864_1006874212 140
21 3300005719 Ga0068861_100074078 Ga0068861_1000740784 140
22 3300005841 Ga0068863_100057940 Ga0068863_1000579402 140
23 3300005841 Ga0068863_100789726 Ga0068863_1007897262 140
24 3300005843 Ga0068860_100007586 Ga0068860_1000075864 140
25 3300005843 Ga0068860_100049562 Ga0068860_1000495622 140
26 3300005843 Ga0068860_100121412 Ga0068860_1001214124 140
27 3300005844 Ga0068862_100046002 Ga0068862_1000460024 140
28 3300005844 Ga0068862_100536315 Ga0068862_1005363151 140
29 3300006028 Ga0070717_10023828 Ga0070717_100238284 140
30 3300006358 Ga0068871_100496038 Ga0068871_1004960382 140
31 3300006881 Ga0068865_100514355 Ga0068865_1005143552 140
32 3300006931 Ga0097620_100053624 Ga0097620_1000536245 140
33 3300009174 Ga0105241_10059163 Ga0105241_100591634 140
34 3300009177 Ga0105248_10010627 Ga0105248_100106277 140
35 3300009177 Ga0105248_10041237 Ga0105248_100412375 140
36 3300009177 Ga0105248_10336442 Ga0105248_103364422 140
37 3300009551 Ga0105238_10080642 Ga0105238_100806422 140
38 3300009551 Ga0105238_11200015 Ga0105238_112000151 140
39 3300009553 Ga0105249_10258718 Ga0105249_102587184 140
40 3300009553 Ga0105249_11070061 Ga0105249_110700612 140
41 3300010375 Ga0105239_11183615 Ga0105239_111836152 140
42 3300013306 Ga0163162_10158089 Ga0163162_101580892 140
43 3300013308 Ga0157375_10036322 Ga0157375_100363223 140
44 3300014325 Ga0163163_10063277 Ga0163163_100632773 140
45 3300014325 Ga0163163_10073321 Ga0163163_100733212 140
46 3300014326 Ga0157380_10073811 Ga0157380_100738115 140
47 3300025254 Ga0209148_1010189 Ga0209148_10101893 140
48 3300025903 Ga0207680_10132774 Ga0207680_101327742 140
49 3300025903 Ga0207680_10355444 Ga0207680_103554442 140
50 3300025909 Ga0207705_10293291 Ga0207705_102932912 140
51 3300025911 Ga0207654_10910812 Ga0207654_109108122 140
52 3300025913 Ga0207695_10001997 Ga0207695_100019974 140
53 3300025921 Ga0207652_10134163 Ga0207652_101341632 140
54 3300025924 Ga0207694_10222501 Ga0207694_102225012 140
55 3300025925 Ga0207650_10155644 Ga0207650_101556442 140
56 3300025931 Ga0207644_10063547 Ga0207644_100635474 140
57 3300025941 Ga0207711_10001176 Ga0207711_100011765 140
58 3300025941 Ga0207711_10051504 Ga0207711_100515045 140
59 3300025941 Ga0207711_10063721 Ga0207711_100637214 140
60 3300025944 Ga0207661_10444759 Ga0207661_104447592 140
61 3300025945 Ga0207679_10058189 Ga0207679_100581892 140
62 3300025949 Ga0207667_10904232 Ga0207667_109042321 140
63 3300025960 Ga0207651_10029720 Ga0207651_100297202 140
64 3300025961 Ga0207712_10195048 Ga0207712_101950484 140
65 3300025972 Ga0207668_10000004 Ga0207668_10000004194 140
66 3300025972 Ga0207668_10003898 Ga0207668_100038982 140
67 3300025972 Ga0207668_10118062 Ga0207668_101180623 140
68 3300025986 Ga0207658_10096515 Ga0207658_100965154 140
69 3300025986 Ga0207658_10517655 Ga0207658_105176552 140
70 3300025986 Ga0207658_10588890 Ga0207658_105888902 140
71 3300025986 Ga0207658_10702385 Ga0207658_107023852 140
72 3300026023 Ga0207677_10102421 Ga0207677_101024212 140
73 3300026035 Ga0207703_10461059 Ga0207703_104610592 140
74 3300026041 Ga0207639_10088921 Ga0207639_100889213 140
75 3300026088 Ga0207641_10060475 Ga0207641_100604755 140
76 3300026088 Ga0207641_10063398 Ga0207641_100633983 140
77 3300026088 Ga0207641_10096960 Ga0207641_100969603 140
78 3300026095 Ga0207676_10044408 Ga0207676_100444083 140
79 3300026095 Ga0207676_10277385 Ga0207676_102773854 140
80 3300026118 Ga0207675_100088067 Ga0207675_1000880672 140
81 3300026121 Ga0207683_10176932 Ga0207683_101769322 140
82 3300027543 Ga0209999_1006174 Ga0209999_10061742 140
83 3300027665 Ga0209983_1014266 Ga0209983_10142662 140
84 3300027876 Ga0209974_10156134 Ga0209974_101561342 140
85 3300028379 Ga0268266_10000970 Ga0268266_1000097015 140
86 3300028380 Ga0268265_10001167 Ga0268265_1000116712 140
87 3300028380 Ga0268265_10064875 Ga0268265_100648753 140
88 3300028381 Ga0268264_10000091 Ga0268264_1000009127 140
89 3300028381 Ga0268264_10061776 Ga0268264_100617763 140
90 3300028381 Ga0268264_10100817 Ga0268264_101008172 140
91 3300028786 Ga0307517_10003229 Ga0307517_100032298 140
92 3300031456 Ga0307513_10004517 Ga0307513_100045177 140
93 3300031616 Ga0307508_10355239 Ga0307508_103552392 140
94 3300031730 Ga0307516_10001321 Ga0307516_1000132114 140
95 3300033180 Ga0307510_10004465 Ga0307510_100044657 140
96 3300037471 Ga0395905_0208309 Ga0395905_0208309_1330_1764 140
97 3300038443 Ga0395901_0278854 Ga0395901_0278854_822_1256 140
98 3300039437 Ga0436365_0349879 Ga0436365_0349879_187_609 140
99 3300046491 Ga0495584_0651446 Ga0495584_0651446_64_516 140
100 3300046660 Ga0495625_0131383 Ga0495625_0131383_566_1051 140
101 3300046684 Ga0495669_0000006 Ga0495669_0000006_108132_108617 140
102 3300047318 Ga0495636_0034651 Ga0495636_0034651_1021_1473 140
103 3300047445 Ga0495677_0010022 Ga0495677_0010022_675_1160 140
104 3300048905 Ga0496102_0043292 Ga0496102_0043292_3350_3802 140
105 3300048907 Ga0496104_0379372 Ga0496104_0379372_434_886 140
106 3300048909 Ga0496106_0388195 Ga0496106_0388195_614_1066 140
107 3300048911 Ga0496108_0049118 Ga0496108_0049118_1315_1767 140
108 3300048915 Ga0496112_0097568 Ga0496112_0097568_1651_2103 140
109 3300048918 Ga0496115_0001441 Ga0496115_0001441_2217_2660 140
110 3300048918 Ga0496115_0201308 Ga0496115_0201308_1082_1516 140
111 3300048929 Ga0496126_0254011 Ga0496126_0254011_191_664 140
112 3300049571 Ga0501034_0381249 Ga0501034_0381249_602_1054 140
113 3300049571 Ga0501034_0534574 Ga0501034_0534574_90_572 140
114 3300049581 Ga0501047_0086708 Ga0501047_0086708_1781_2215 140
115 3300049581 Ga0501047_1183816 Ga0501047_1183816_14_466 140
116 3300049582 Ga0501048_0101125 Ga0501048_0101125_716_1198 140
117 3300049585 Ga0501069_0972943 Ga0501069_0972943_56_508 140
118 3300049686 Ga0501257_113824 Ga0501257_113824_31_504 140
119 3300049822 Ga0501035_0900475 Ga0501035_0900475_44_526 140
120 3300050495 nmdc:mga04h51_461693_c1 nmdc:mga04h51_461693_c1_43_528 140
121 3300053087 Ga0500643_007002 Ga0500643_007002_3548_3982 140
122 3300053108 Ga0500562_000903 Ga0500562_000903_4482_4931 140
123 iso_pu_bacteria 2510917020 2511121902 140
124 iso_pu_bacteria 2643221583 2643926967 140
125 3300053153 Ga0500616_0026684 Ga0500616_0026684_177_614 143
126 3300003316 rootH1_10131028 rootH1_101310282 144
127 3300003771 Ga0055526_1073369 Ga0055526_10733692 144
128 3300005262 Ga0065165_1001140 Ga0065165_10011409 144
129 3300005353 Ga0070669_101897237 Ga0070669_1018972371 144
130 3300006195 Ga0075366_10283418 Ga0075366_102834181 144
131 3300025295 Ga0209564_1001621 Ga0209564_100162119 144
132 3300025295 Ga0209564_1031698 Ga0209564_10316982 144
133 3300025913 Ga0207695_10127566 Ga0207695_101275662 144
134 3300026067 Ga0207678_10585310 Ga0207678_105853102 144
135 3300041413 Ga0439465_0084929 Ga0439465_0084929_188_622 144
136 3300042156 Ga0439446_0040802 Ga0439446_0040802_691_1125 144
137 3300042436 Ga0439435_0129360 Ga0439435_0129360_297_731 144
138 3300042438 Ga0439459_0008077 Ga0439459_0008077_247_681 144
139 3300046453 Ga0495627_000513 Ga0495627_000513_6207_6641 144
140 3300046506 Ga0495583_0000399 Ga0495583_0000399_3912_4346 144
141 3300046542 Ga0495597_0038686 Ga0495597_0038686_159_605 144
142 3300046660 Ga0495625_0005971 Ga0495625_0005971_10414_10848 144
143 3300046794 Ga0495589_0011506 Ga0495589_0011506_2353_2787 144
144 3300046810 Ga0495660_0030687 Ga0495660_0030687_724_1158 144
145 3300046810 Ga0495660_0158920 Ga0495660_0158920_275_709 144
146 3300047446 Ga0495679_005578 Ga0495679_005578_1801_2235 144
147 3300048927 Ga0496124_0018893 Ga0496124_0018893_4262_4708 144
148 3300050493 nmdc:mga0k408_58505_c1 nmdc:mga0k408_58505_c1_190_624 144
149 3300050516 nmdc:mga0sz30_4463_c1 nmdc:mga0sz30_4463_c1_826_1272 144
150 3300053087 Ga0500643_045675 Ga0500643_045675_819_1253 144
151 3300053119 Ga0500595_005021 Ga0500595_005021_3454_3948 144
152 3300053125 Ga0500618_000152 Ga0500618_000152_49326_49760 144
153 3300053136 Ga0500559_0000054 Ga0500559_0000054_55561_55995 144
154 3300053136 Ga0500559_0009580 Ga0500559_0009580_914_1372 144
155 3300053136 Ga0500559_0021269 Ga0500559_0021269_255_689 144
156 3300053142 Ga0500577_0041536 Ga0500577_0041536_955_1389 144
157 3300053156 Ga0500622_0074464 Ga0500622_0074464_807_1241 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

3

95

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqf-assembly2.cif.gz_B structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.8316 1 143
3tqf-assembly1.cif.gz_A structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.8212 1 143
3tqf-assembly2.cif.gz_B structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.821 1 143
6at3-assembly1.cif.gz_A e. coli phosphoenolpyruvate carboxykinase y207f mutant bound to thiosulfate and oxaloacetate 0.8156 2 49
3tqf-assembly1.cif.gz_A structure of the hpr(ser) kinase/phosphatase from coxiella burnetii 0.8109 1 143
ID Description Score Start End Superfamily
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8424 1 143 3.40.50.300
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8317 1 143 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7635 17 39 3.40.50.300
2qmhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7509 1 143 3.40.50.300
1knxD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7431 1 142 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2M7QL68-F1-model_v4 Serine kinase 0.9926 1 83 GO:0000155
GO:0005524
GO:0006109
AF-A0A521QQM8-F1-model_v4 Serine kinase 0.9778 1 91 GO:0000155
GO:0005524
GO:0006109
AF-A0A2Z3HQ06-F1-model_v4 Serine kinase 0.9724 1 137 GO:0000155
GO:0005524
GO:0006109
AF-E8RQI1-F1-model_v4 HPr kinase 0.9697 1 140 GO:0000155
GO:0005524
GO:0006109
AF-A0A258FJM0-F1-model_v4 HPr kinase/phosphorylase C-terminal domain-containing protein 0.9677 3 135 GO:0000155
GO:0005524
GO:0006109

Feature Viewer

pLDDT pTM Quality
92.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map