F228428
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 157 | 118 | 155 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_005021|Ga0500595_005021_3454_3948 |
| Length | 164 |
| Sequence | MTSEIRHAGLIALRLGGFWRGVLIEGPSGVGKSDLALRALDAGFQLVADDRTLVFLSGGRLYGRAPGPLSGLIECRGLGIMGAPSLPFAQIALVLHCEAVPEAVDRMPEPTVQTVLGQPAPLLRLWPFEASAPAKLRRALEVLGRSAQEAYQATLAPPRRRLGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 72 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 73 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 74 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 75 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 79 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 80 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 81 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 82 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 83 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 95 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 96 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 97 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 99 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 100 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 101 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 102 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 107 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 109 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 110 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 111 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 112 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 113 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 114 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 115 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 116 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 117 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 118 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.73 |
| Metatranscriptomes | 0 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.38 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 75.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10131028 | 3300003316 | Bacteria | 1112 |
| 2 | Ga0055526_1073369 | 3300003771 | Bacteria | 687 |
| 3 | Ga0065165_1001140 | 3300005262 | Bacteria | 31153 |
| 4 | Ga0070658_10138574 | 3300005327 | Bacteria | 2031 |
| 5 | Ga0070670_100052577 | 3300005331 | Bacteria | 3498 |
| 6 | Ga0070666_10527168 | 3300005335 | Bacteria | 858 |
| 7 | Ga0070660_101563578 | 3300005339 | Bacteria | 561 |
| 8 | Ga0070668_100002879 | 3300005347 | Bacteria | 12697 |
| 9 | Ga0070668_100079645 | 3300005347 | Bacteria | 2565 |
| 10 | Ga0070668_100110192 | 3300005347 | Bacteria | 2190 |
| 11 | Ga0070668_100193945 | 3300005347 | Bacteria | 1665 |
| 12 | Ga0070669_101897237 | 3300005353 | Bacteria | 520 |
| 13 | Ga0070671_100028714 | 3300005355 | Bacteria | 4583 |
| 14 | Ga0070673_100032309 | 3300005364 | Bacteria | 3939 |
| 15 | Ga0070667_100602913 | 3300005367 | Bacteria | 1012 |
| 16 | Ga0070667_101287792 | 3300005367 | Bacteria | 685 |
| 17 | Ga0070678_100116440 | 3300005456 | Bacteria | 2100 |
| 18 | Ga0070679_100705353 | 3300005530 | Bacteria | 952 |
| 19 | Ga0070665_100000667 | 3300005548 | Bacteria | 46192 |
| 20 | Ga0068859_100053626 | 3300005617 | Bacteria | 4056 |
| 21 | Ga0068864_100056735 | 3300005618 | Bacteria | 3383 |
| 22 | Ga0068864_100687421 | 3300005618 | Bacteria | 999 |
| 23 | Ga0068861_100074078 | 3300005719 | Bacteria | 2647 |
| 24 | Ga0068863_100057940 | 3300005841 | Bacteria | 3666 |
| 25 | Ga0068863_100789726 | 3300005841 | Bacteria | 947 |
| 26 | Ga0068860_100007586 | 3300005843 | Bacteria | 10857 |
| 27 | Ga0068860_100049562 | 3300005843 | Bacteria | 3999 |
| 28 | Ga0068860_100121412 | 3300005843 | Bacteria | 2502 |
| 29 | Ga0068862_100046002 | 3300005844 | Bacteria | 3725 |
| 30 | Ga0068862_100536315 | 3300005844 | Bacteria | 1115 |
| 31 | Ga0070717_10023828 | 3300006028 | Bacteria | 4855 |
| 32 | Ga0075366_10283418 | 3300006195 | Bacteria | 1013 |
| 33 | Ga0075366_10864665 | 3300006195 | Bacteria | 563 |
| 34 | Ga0068871_100496038 | 3300006358 | Bacteria | 1100 |
| 35 | Ga0068865_100514355 | 3300006881 | Bacteria | 1000 |
| 36 | Ga0097620_100053624 | 3300006931 | Bacteria | 4056 |
| 37 | Ga0105241_10059163 | 3300009174 | Bacteria | 2945 |
| 38 | Ga0105248_10010627 | 3300009177 | Bacteria | 10150 |
| 39 | Ga0105248_10041237 | 3300009177 | Bacteria | 5174 |
| 40 | Ga0105248_10336442 | 3300009177 | Bacteria | 1700 |
| 41 | Ga0105238_10080642 | 3300009551 | Bacteria | 3244 |
| 42 | Ga0105238_11200015 | 3300009551 | Bacteria | 783 |
| 43 | Ga0105249_10258718 | 3300009553 | Bacteria | 1728 |
| 44 | Ga0105249_11070061 | 3300009553 | Bacteria | 876 |
| 45 | Ga0105239_11183615 | 3300010375 | Bacteria | 881 |
| 46 | Ga0163162_10158089 | 3300013306 | Bacteria | 2387 |
| 47 | Ga0157375_10036322 | 3300013308 | Bacteria | 4713 |
| 48 | Ga0163163_10063277 | 3300014325 | Bacteria | 3668 |
| 49 | Ga0163163_10073321 | 3300014325 | Bacteria | 3414 |
| 50 | Ga0157380_10073811 | 3300014326 | Bacteria | 2767 |
| 51 | Ga0209148_1010189 | 3300025254 | Bacteria | 1794 |
| 52 | Ga0209564_1001621 | 3300025295 | Bacteria | 21837 |
| 53 | Ga0209564_1031698 | 3300025295 | Bacteria | 1609 |
| 54 | Ga0207680_10132774 | 3300025903 | Bacteria | 1642 |
| 55 | Ga0207680_10355444 | 3300025903 | Bacteria | 1030 |
| 56 | Ga0207705_10293291 | 3300025909 | Bacteria | 1246 |
| 57 | Ga0207654_10910812 | 3300025911 | Bacteria | 638 |
| 58 | Ga0207695_10001997 | 3300025913 | Bacteria | 31506 |
| 59 | Ga0207695_10127566 | 3300025913 | Bacteria | 2505 |
| 60 | Ga0207652_10134163 | 3300025921 | Bacteria | 2210 |
| 61 | Ga0207681_10300922 | 3300025923 | Bacteria | 1269 |
| 62 | Ga0207694_10222501 | 3300025924 | Bacteria | 1540 |
| 63 | Ga0207650_10155644 | 3300025925 | Bacteria | 1807 |
| 64 | Ga0207644_10063547 | 3300025931 | Bacteria | 2680 |
| 65 | Ga0207711_10001176 | 3300025941 | Bacteria | 24900 |
| 66 | Ga0207711_10051504 | 3300025941 | Bacteria | 3526 |
| 67 | Ga0207711_10063721 | 3300025941 | Bacteria | 3183 |
| 68 | Ga0207661_10444759 | 3300025944 | Bacteria | 1180 |
| 69 | Ga0207679_10058189 | 3300025945 | Bacteria | 2862 |
| 70 | Ga0207667_10904232 | 3300025949 | Bacteria | 874 |
| 71 | Ga0207651_10029720 | 3300025960 | Bacteria | 3468 |
| 72 | Ga0207712_10195048 | 3300025961 | Bacteria | 1601 |
| 73 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 74 | Ga0207668_10003898 | 3300025972 | Bacteria | 8790 |
| 75 | Ga0207668_10118062 | 3300025972 | Bacteria | 2003 |
| 76 | Ga0207658_10096515 | 3300025986 | Bacteria | 2305 |
| 77 | Ga0207658_10517655 | 3300025986 | Bacteria | 1064 |
| 78 | Ga0207658_10588890 | 3300025986 | Bacteria | 998 |
| 79 | Ga0207658_10702385 | 3300025986 | Bacteria | 914 |
| 80 | Ga0207677_10102421 | 3300026023 | Bacteria | 2111 |
| 81 | Ga0207703_10461059 | 3300026035 | Bacteria | 1188 |
| 82 | Ga0207639_10088921 | 3300026041 | Bacteria | 2467 |
| 83 | Ga0207678_10585310 | 3300026067 | Bacteria | 978 |
| 84 | Ga0207641_10060475 | 3300026088 | Bacteria | 3229 |
| 85 | Ga0207641_10063398 | 3300026088 | Bacteria | 3157 |
| 86 | Ga0207641_10096960 | 3300026088 | Bacteria | 2591 |
| 87 | Ga0207676_10044408 | 3300026095 | Bacteria | 3428 |
| 88 | Ga0207676_10277385 | 3300026095 | Bacteria | 1520 |
| 89 | Ga0207675_100088067 | 3300026118 | Bacteria | 2916 |
| 90 | Ga0207683_10176932 | 3300026121 | Bacteria | 1934 |
| 91 | Ga0209999_1006174 | 3300027543 | Bacteria | 2152 |
| 92 | Ga0209983_1014266 | 3300027665 | Bacteria | 1637 |
| 93 | Ga0209974_10156134 | 3300027876 | Bacteria | 826 |
| 94 | Ga0268266_10000970 | 3300028379 | Bacteria | 36427 |
| 95 | Ga0268265_10001167 | 3300028380 | Bacteria | 23017 |
| 96 | Ga0268265_10064875 | 3300028380 | Bacteria | 2815 |
| 97 | Ga0268264_10000091 | 3300028381 | Bacteria | 233338 |
| 98 | Ga0268264_10061776 | 3300028381 | Bacteria | 3144 |
| 99 | Ga0268264_10100817 | 3300028381 | Bacteria | 2509 |
| 100 | Ga0307517_10003229 | 3300028786 | Bacteria | 25559 |
| 101 | Ga0307513_10004517 | 3300031456 | Bacteria | 18553 |
| 102 | Ga0307508_10355239 | 3300031616 | Bacteria | 1057 |
| 103 | Ga0307516_10001321 | 3300031730 | Bacteria | 34374 |
| 104 | Ga0307510_10004465 | 3300033180 | Bacteria | 16455 |
| 105 | Ga0395905_0208309 | 3300037471 | Bacteria | 1832 |
| 106 | Ga0395901_0278854 | 3300038443 | Bacteria | 1737 |
| 107 | Ga0436365_0349879 | 3300039437 | Bacteria | 630 |
| 108 | Ga0439465_0084929 | 3300041413 | Bacteria | 1077 |
| 109 | Ga0439446_0040802 | 3300042156 | Bacteria | 1366 |
| 110 | Ga0439435_0129360 | 3300042436 | Bacteria | 796 |
| 111 | Ga0439459_0008077 | 3300042438 | Bacteria | 1791 |
| 112 | Ga0495627_000513 | 3300046453 | Bacteria | 32122 |
| 113 | Ga0495584_0651446 | 3300046491 | Unclassified | 537 |
| 114 | Ga0495583_0000399 | 3300046506 | Bacteria | 66020 |
| 115 | Ga0495597_0038686 | 3300046542 | Bacteria | 2137 |
| 116 | Ga0495625_0005971 | 3300046660 | Bacteria | 10945 |
| 117 | Ga0495625_0131383 | 3300046660 | Bacteria | 1696 |
| 118 | Ga0495669_0000006 | 3300046684 | Bacteria | 190838 |
| 119 | Ga0495589_0011506 | 3300046794 | Bacteria | 4594 |
| 120 | Ga0495660_0030687 | 3300046810 | Bacteria | 3027 |
| 121 | Ga0495660_0158920 | 3300046810 | Bacteria | 1110 |
| 122 | Ga0495636_0034651 | 3300047318 | Bacteria | 2078 |
| 123 | Ga0495677_0010022 | 3300047445 | Bacteria | 3487 |
| 124 | Ga0495679_005578 | 3300047446 | Bacteria | 5552 |
| 125 | Ga0496102_0043292 | 3300048905 | Bacteria | 4082 |
| 126 | Ga0496104_0379372 | 3300048907 | Bacteria | 1326 |
| 127 | Ga0496106_0388195 | 3300048909 | Bacteria | 1122 |
| 128 | Ga0496108_0049118 | 3300048911 | Bacteria | 3529 |
| 129 | Ga0496112_0097568 | 3300048915 | Bacteria | 2909 |
| 130 | Ga0496115_0001441 | 3300048918 | Bacteria | 17034 |
| 131 | Ga0496115_0201308 | 3300048918 | Bacteria | 1645 |
| 132 | Ga0496124_0018893 | 3300048927 | Bacteria | 6435 |
| 133 | Ga0496126_0254011 | 3300048929 | Bacteria | 1464 |
| 134 | Ga0501034_0381249 | 3300049571 | Bacteria | 1335 |
| 135 | Ga0501034_0534574 | 3300049571 | Bacteria | 1083 |
| 136 | Ga0501047_0086708 | 3300049581 | Bacteria | 3008 |
| 137 | Ga0501047_1183816 | 3300049581 | Bacteria | 578 |
| 138 | Ga0501048_0101125 | 3300049582 | Bacteria | 2034 |
| 139 | Ga0501069_0972943 | 3300049585 | Bacteria | 518 |
| 140 | Ga0501257_113824 | 3300049686 | Bacteria | 719 |
| 141 | Ga0501035_0900475 | 3300049822 | Bacteria | 701 |
| 142 | nmdc:mga0k408_58505_c1 | 3300050493 | Bacteria | 2238 |
| 143 | nmdc:mga04h51_461693_c1 | 3300050495 | Bacteria | 538 |
| 144 | nmdc:mga0sz30_4463_c1 | 3300050516 | Bacteria | 3023 |
| 145 | Ga0500643_007002 | 3300053087 | Bacteria | 4625 |
| 146 | Ga0500643_045675 | 3300053087 | Bacteria | 1268 |
| 147 | Ga0500562_000903 | 3300053108 | Bacteria | 7198 |
| 148 | Ga0500595_005021 | 3300053119 | Bacteria | 5828 |
| 149 | Ga0500618_000152 | 3300053125 | Bacteria | 57055 |
| 150 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 151 | Ga0500559_0009580 | 3300053136 | Bacteria | 4184 |
| 152 | Ga0500559_0021269 | 3300053136 | Bacteria | 2748 |
| 153 | Ga0500577_0041536 | 3300053142 | Bacteria | 1678 |
| 154 | Ga0500616_0026684 | 3300053153 | Bacteria | 3195 |
| 155 | Ga0500622_0074464 | 3300053156 | Bacteria | 1710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10300922 | Ga0207681_103009222 | 132 |
| 2 | 3300006195 | Ga0075366_10864665 | Ga0075366_108646651 | 134 |
| 3 | 3300005327 | Ga0070658_10138574 | Ga0070658_101385742 | 140 |
| 4 | 3300005331 | Ga0070670_100052577 | Ga0070670_1000525773 | 140 |
| 5 | 3300005335 | Ga0070666_10527168 | Ga0070666_105271682 | 140 |
| 6 | 3300005339 | Ga0070660_101563578 | Ga0070660_1015635781 | 140 |
| 7 | 3300005347 | Ga0070668_100002879 | Ga0070668_1000028795 | 140 |
| 8 | 3300005347 | Ga0070668_100079645 | Ga0070668_1000796453 | 140 |
| 9 | 3300005347 | Ga0070668_100110192 | Ga0070668_1001101923 | 140 |
| 10 | 3300005347 | Ga0070668_100193945 | Ga0070668_1001939454 | 140 |
| 11 | 3300005355 | Ga0070671_100028714 | Ga0070671_1000287144 | 140 |
| 12 | 3300005364 | Ga0070673_100032309 | Ga0070673_1000323095 | 140 |
| 13 | 3300005367 | Ga0070667_100602913 | Ga0070667_1006029132 | 140 |
| 14 | 3300005367 | Ga0070667_101287792 | Ga0070667_1012877921 | 140 |
| 15 | 3300005456 | Ga0070678_100116440 | Ga0070678_1001164402 | 140 |
| 16 | 3300005530 | Ga0070679_100705353 | Ga0070679_1007053532 | 140 |
| 17 | 3300005548 | Ga0070665_100000667 | Ga0070665_10000066749 | 140 |
| 18 | 3300005617 | Ga0068859_100053626 | Ga0068859_1000536265 | 140 |
| 19 | 3300005618 | Ga0068864_100056735 | Ga0068864_1000567353 | 140 |
| 20 | 3300005618 | Ga0068864_100687421 | Ga0068864_1006874212 | 140 |
| 21 | 3300005719 | Ga0068861_100074078 | Ga0068861_1000740784 | 140 |
| 22 | 3300005841 | Ga0068863_100057940 | Ga0068863_1000579402 | 140 |
| 23 | 3300005841 | Ga0068863_100789726 | Ga0068863_1007897262 | 140 |
| 24 | 3300005843 | Ga0068860_100007586 | Ga0068860_1000075864 | 140 |
| 25 | 3300005843 | Ga0068860_100049562 | Ga0068860_1000495622 | 140 |
| 26 | 3300005843 | Ga0068860_100121412 | Ga0068860_1001214124 | 140 |
| 27 | 3300005844 | Ga0068862_100046002 | Ga0068862_1000460024 | 140 |
| 28 | 3300005844 | Ga0068862_100536315 | Ga0068862_1005363151 | 140 |
| 29 | 3300006028 | Ga0070717_10023828 | Ga0070717_100238284 | 140 |
| 30 | 3300006358 | Ga0068871_100496038 | Ga0068871_1004960382 | 140 |
| 31 | 3300006881 | Ga0068865_100514355 | Ga0068865_1005143552 | 140 |
| 32 | 3300006931 | Ga0097620_100053624 | Ga0097620_1000536245 | 140 |
| 33 | 3300009174 | Ga0105241_10059163 | Ga0105241_100591634 | 140 |
| 34 | 3300009177 | Ga0105248_10010627 | Ga0105248_100106277 | 140 |
| 35 | 3300009177 | Ga0105248_10041237 | Ga0105248_100412375 | 140 |
| 36 | 3300009177 | Ga0105248_10336442 | Ga0105248_103364422 | 140 |
| 37 | 3300009551 | Ga0105238_10080642 | Ga0105238_100806422 | 140 |
| 38 | 3300009551 | Ga0105238_11200015 | Ga0105238_112000151 | 140 |
| 39 | 3300009553 | Ga0105249_10258718 | Ga0105249_102587184 | 140 |
| 40 | 3300009553 | Ga0105249_11070061 | Ga0105249_110700612 | 140 |
| 41 | 3300010375 | Ga0105239_11183615 | Ga0105239_111836152 | 140 |
| 42 | 3300013306 | Ga0163162_10158089 | Ga0163162_101580892 | 140 |
| 43 | 3300013308 | Ga0157375_10036322 | Ga0157375_100363223 | 140 |
| 44 | 3300014325 | Ga0163163_10063277 | Ga0163163_100632773 | 140 |
| 45 | 3300014325 | Ga0163163_10073321 | Ga0163163_100733212 | 140 |
| 46 | 3300014326 | Ga0157380_10073811 | Ga0157380_100738115 | 140 |
| 47 | 3300025254 | Ga0209148_1010189 | Ga0209148_10101893 | 140 |
| 48 | 3300025903 | Ga0207680_10132774 | Ga0207680_101327742 | 140 |
| 49 | 3300025903 | Ga0207680_10355444 | Ga0207680_103554442 | 140 |
| 50 | 3300025909 | Ga0207705_10293291 | Ga0207705_102932912 | 140 |
| 51 | 3300025911 | Ga0207654_10910812 | Ga0207654_109108122 | 140 |
| 52 | 3300025913 | Ga0207695_10001997 | Ga0207695_100019974 | 140 |
| 53 | 3300025921 | Ga0207652_10134163 | Ga0207652_101341632 | 140 |
| 54 | 3300025924 | Ga0207694_10222501 | Ga0207694_102225012 | 140 |
| 55 | 3300025925 | Ga0207650_10155644 | Ga0207650_101556442 | 140 |
| 56 | 3300025931 | Ga0207644_10063547 | Ga0207644_100635474 | 140 |
| 57 | 3300025941 | Ga0207711_10001176 | Ga0207711_100011765 | 140 |
| 58 | 3300025941 | Ga0207711_10051504 | Ga0207711_100515045 | 140 |
| 59 | 3300025941 | Ga0207711_10063721 | Ga0207711_100637214 | 140 |
| 60 | 3300025944 | Ga0207661_10444759 | Ga0207661_104447592 | 140 |
| 61 | 3300025945 | Ga0207679_10058189 | Ga0207679_100581892 | 140 |
| 62 | 3300025949 | Ga0207667_10904232 | Ga0207667_109042321 | 140 |
| 63 | 3300025960 | Ga0207651_10029720 | Ga0207651_100297202 | 140 |
| 64 | 3300025961 | Ga0207712_10195048 | Ga0207712_101950484 | 140 |
| 65 | 3300025972 | Ga0207668_10000004 | Ga0207668_10000004194 | 140 |
| 66 | 3300025972 | Ga0207668_10003898 | Ga0207668_100038982 | 140 |
| 67 | 3300025972 | Ga0207668_10118062 | Ga0207668_101180623 | 140 |
| 68 | 3300025986 | Ga0207658_10096515 | Ga0207658_100965154 | 140 |
| 69 | 3300025986 | Ga0207658_10517655 | Ga0207658_105176552 | 140 |
| 70 | 3300025986 | Ga0207658_10588890 | Ga0207658_105888902 | 140 |
| 71 | 3300025986 | Ga0207658_10702385 | Ga0207658_107023852 | 140 |
| 72 | 3300026023 | Ga0207677_10102421 | Ga0207677_101024212 | 140 |
| 73 | 3300026035 | Ga0207703_10461059 | Ga0207703_104610592 | 140 |
| 74 | 3300026041 | Ga0207639_10088921 | Ga0207639_100889213 | 140 |
| 75 | 3300026088 | Ga0207641_10060475 | Ga0207641_100604755 | 140 |
| 76 | 3300026088 | Ga0207641_10063398 | Ga0207641_100633983 | 140 |
| 77 | 3300026088 | Ga0207641_10096960 | Ga0207641_100969603 | 140 |
| 78 | 3300026095 | Ga0207676_10044408 | Ga0207676_100444083 | 140 |
| 79 | 3300026095 | Ga0207676_10277385 | Ga0207676_102773854 | 140 |
| 80 | 3300026118 | Ga0207675_100088067 | Ga0207675_1000880672 | 140 |
| 81 | 3300026121 | Ga0207683_10176932 | Ga0207683_101769322 | 140 |
| 82 | 3300027543 | Ga0209999_1006174 | Ga0209999_10061742 | 140 |
| 83 | 3300027665 | Ga0209983_1014266 | Ga0209983_10142662 | 140 |
| 84 | 3300027876 | Ga0209974_10156134 | Ga0209974_101561342 | 140 |
| 85 | 3300028379 | Ga0268266_10000970 | Ga0268266_1000097015 | 140 |
| 86 | 3300028380 | Ga0268265_10001167 | Ga0268265_1000116712 | 140 |
| 87 | 3300028380 | Ga0268265_10064875 | Ga0268265_100648753 | 140 |
| 88 | 3300028381 | Ga0268264_10000091 | Ga0268264_1000009127 | 140 |
| 89 | 3300028381 | Ga0268264_10061776 | Ga0268264_100617763 | 140 |
| 90 | 3300028381 | Ga0268264_10100817 | Ga0268264_101008172 | 140 |
| 91 | 3300028786 | Ga0307517_10003229 | Ga0307517_100032298 | 140 |
| 92 | 3300031456 | Ga0307513_10004517 | Ga0307513_100045177 | 140 |
| 93 | 3300031616 | Ga0307508_10355239 | Ga0307508_103552392 | 140 |
| 94 | 3300031730 | Ga0307516_10001321 | Ga0307516_1000132114 | 140 |
| 95 | 3300033180 | Ga0307510_10004465 | Ga0307510_100044657 | 140 |
| 96 | 3300037471 | Ga0395905_0208309 | Ga0395905_0208309_1330_1764 | 140 |
| 97 | 3300038443 | Ga0395901_0278854 | Ga0395901_0278854_822_1256 | 140 |
| 98 | 3300039437 | Ga0436365_0349879 | Ga0436365_0349879_187_609 | 140 |
| 99 | 3300046491 | Ga0495584_0651446 | Ga0495584_0651446_64_516 | 140 |
| 100 | 3300046660 | Ga0495625_0131383 | Ga0495625_0131383_566_1051 | 140 |
| 101 | 3300046684 | Ga0495669_0000006 | Ga0495669_0000006_108132_108617 | 140 |
| 102 | 3300047318 | Ga0495636_0034651 | Ga0495636_0034651_1021_1473 | 140 |
| 103 | 3300047445 | Ga0495677_0010022 | Ga0495677_0010022_675_1160 | 140 |
| 104 | 3300048905 | Ga0496102_0043292 | Ga0496102_0043292_3350_3802 | 140 |
| 105 | 3300048907 | Ga0496104_0379372 | Ga0496104_0379372_434_886 | 140 |
| 106 | 3300048909 | Ga0496106_0388195 | Ga0496106_0388195_614_1066 | 140 |
| 107 | 3300048911 | Ga0496108_0049118 | Ga0496108_0049118_1315_1767 | 140 |
| 108 | 3300048915 | Ga0496112_0097568 | Ga0496112_0097568_1651_2103 | 140 |
| 109 | 3300048918 | Ga0496115_0001441 | Ga0496115_0001441_2217_2660 | 140 |
| 110 | 3300048918 | Ga0496115_0201308 | Ga0496115_0201308_1082_1516 | 140 |
| 111 | 3300048929 | Ga0496126_0254011 | Ga0496126_0254011_191_664 | 140 |
| 112 | 3300049571 | Ga0501034_0381249 | Ga0501034_0381249_602_1054 | 140 |
| 113 | 3300049571 | Ga0501034_0534574 | Ga0501034_0534574_90_572 | 140 |
| 114 | 3300049581 | Ga0501047_0086708 | Ga0501047_0086708_1781_2215 | 140 |
| 115 | 3300049581 | Ga0501047_1183816 | Ga0501047_1183816_14_466 | 140 |
| 116 | 3300049582 | Ga0501048_0101125 | Ga0501048_0101125_716_1198 | 140 |
| 117 | 3300049585 | Ga0501069_0972943 | Ga0501069_0972943_56_508 | 140 |
| 118 | 3300049686 | Ga0501257_113824 | Ga0501257_113824_31_504 | 140 |
| 119 | 3300049822 | Ga0501035_0900475 | Ga0501035_0900475_44_526 | 140 |
| 120 | 3300050495 | nmdc:mga04h51_461693_c1 | nmdc:mga04h51_461693_c1_43_528 | 140 |
| 121 | 3300053087 | Ga0500643_007002 | Ga0500643_007002_3548_3982 | 140 |
| 122 | 3300053108 | Ga0500562_000903 | Ga0500562_000903_4482_4931 | 140 |
| 123 | iso_pu_bacteria | 2510917020 | 2511121902 | 140 |
| 124 | iso_pu_bacteria | 2643221583 | 2643926967 | 140 |
| 125 | 3300053153 | Ga0500616_0026684 | Ga0500616_0026684_177_614 | 143 |
| 126 | 3300003316 | rootH1_10131028 | rootH1_101310282 | 144 |
| 127 | 3300003771 | Ga0055526_1073369 | Ga0055526_10733692 | 144 |
| 128 | 3300005262 | Ga0065165_1001140 | Ga0065165_10011409 | 144 |
| 129 | 3300005353 | Ga0070669_101897237 | Ga0070669_1018972371 | 144 |
| 130 | 3300006195 | Ga0075366_10283418 | Ga0075366_102834181 | 144 |
| 131 | 3300025295 | Ga0209564_1001621 | Ga0209564_100162119 | 144 |
| 132 | 3300025295 | Ga0209564_1031698 | Ga0209564_10316982 | 144 |
| 133 | 3300025913 | Ga0207695_10127566 | Ga0207695_101275662 | 144 |
| 134 | 3300026067 | Ga0207678_10585310 | Ga0207678_105853102 | 144 |
| 135 | 3300041413 | Ga0439465_0084929 | Ga0439465_0084929_188_622 | 144 |
| 136 | 3300042156 | Ga0439446_0040802 | Ga0439446_0040802_691_1125 | 144 |
| 137 | 3300042436 | Ga0439435_0129360 | Ga0439435_0129360_297_731 | 144 |
| 138 | 3300042438 | Ga0439459_0008077 | Ga0439459_0008077_247_681 | 144 |
| 139 | 3300046453 | Ga0495627_000513 | Ga0495627_000513_6207_6641 | 144 |
| 140 | 3300046506 | Ga0495583_0000399 | Ga0495583_0000399_3912_4346 | 144 |
| 141 | 3300046542 | Ga0495597_0038686 | Ga0495597_0038686_159_605 | 144 |
| 142 | 3300046660 | Ga0495625_0005971 | Ga0495625_0005971_10414_10848 | 144 |
| 143 | 3300046794 | Ga0495589_0011506 | Ga0495589_0011506_2353_2787 | 144 |
| 144 | 3300046810 | Ga0495660_0030687 | Ga0495660_0030687_724_1158 | 144 |
| 145 | 3300046810 | Ga0495660_0158920 | Ga0495660_0158920_275_709 | 144 |
| 146 | 3300047446 | Ga0495679_005578 | Ga0495679_005578_1801_2235 | 144 |
| 147 | 3300048927 | Ga0496124_0018893 | Ga0496124_0018893_4262_4708 | 144 |
| 148 | 3300050493 | nmdc:mga0k408_58505_c1 | nmdc:mga0k408_58505_c1_190_624 | 144 |
| 149 | 3300050516 | nmdc:mga0sz30_4463_c1 | nmdc:mga0sz30_4463_c1_826_1272 | 144 |
| 150 | 3300053087 | Ga0500643_045675 | Ga0500643_045675_819_1253 | 144 |
| 151 | 3300053119 | Ga0500595_005021 | Ga0500595_005021_3454_3948 | 144 |
| 152 | 3300053125 | Ga0500618_000152 | Ga0500618_000152_49326_49760 | 144 |
| 153 | 3300053136 | Ga0500559_0000054 | Ga0500559_0000054_55561_55995 | 144 |
| 154 | 3300053136 | Ga0500559_0009580 | Ga0500559_0009580_914_1372 | 144 |
| 155 | 3300053136 | Ga0500559_0021269 | Ga0500559_0021269_255_689 | 144 |
| 156 | 3300053142 | Ga0500577_0041536 | Ga0500577_0041536_955_1389 | 144 |
| 157 | 3300053156 | Ga0500622_0074464 | Ga0500622_0074464_807_1241 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqf-assembly2.cif.gz_B | structure of the hpr(ser) kinase/phosphatase from coxiella burnetii | 0.8316 | 1 | 143 |
| 3tqf-assembly1.cif.gz_A | structure of the hpr(ser) kinase/phosphatase from coxiella burnetii | 0.8212 | 1 | 143 |
| 3tqf-assembly2.cif.gz_B | structure of the hpr(ser) kinase/phosphatase from coxiella burnetii | 0.821 | 1 | 143 |
| 6at3-assembly1.cif.gz_A | e. coli phosphoenolpyruvate carboxykinase y207f mutant bound to thiosulfate and oxaloacetate | 0.8156 | 2 | 49 |
| 3tqf-assembly1.cif.gz_A | structure of the hpr(ser) kinase/phosphatase from coxiella burnetii | 0.8109 | 1 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8424 | 1 | 143 | 3.40.50.300 |
| 3tqfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8317 | 1 | 143 | 3.40.50.300 |
| af_P96394_152_310_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7635 | 17 | 39 | 3.40.50.300 |
| 2qmhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7509 | 1 | 143 | 3.40.50.300 |
| 1knxD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7431 | 1 | 142 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7QL68-F1-model_v4 | Serine kinase | 0.9926 | 1 | 83 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A521QQM8-F1-model_v4 | Serine kinase | 0.9778 | 1 | 91 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A2Z3HQ06-F1-model_v4 | Serine kinase | 0.9724 | 1 | 137 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-E8RQI1-F1-model_v4 | HPr kinase | 0.9697 | 1 | 140 |
GO:0000155
GO:0005524 GO:0006109 |
| AF-A0A258FJM0-F1-model_v4 | HPr kinase/phosphorylase C-terminal domain-containing protein | 0.9677 | 3 | 135 |
GO:0000155
GO:0005524 GO:0006109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar