F229822

General Info

Members Datasets Scaffolds Average Seq Length
158 105 317 220

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10011083|Ga0207671_100110836
Length 218
Sequence MNFLSHYYFDRDVTNCYHILGTVLPDLLKNADKTIVLHPEKLHHQNEHVNSIIKGWNKHLEVDKYFHSSNFFLTHSHQLKKELAPVIEGSPVKPFFLGHIALELILDNLLITTNNFYEHIQSCDDAIIQEFLTFAGLADSTKFFRFFNGFKKDGYLHTYSETPKIAYALKRICMRVWKDPFTDEHEEAINEVVVVYREHIYDDFMQIFNEIDNKLTPN

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
97 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
98 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
101 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
102 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
103 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
104 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
105 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 0
Rhizoplane 0
Rhizosphere 77.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10011083 3300025914 Bacteria 7374
2 JGI24740J21852_10018922 3300001979 Bacteria 2433
3 JGI24737J22298_10003858 3300001990 Bacteria 5270
4 JGI24735J21928_10005118 3300002067 Bacteria 4366
5 JGI25162J39368_1000059 3300002737 Bacteria 138925
6 JGI25162J39368_1000823 3300002737 Bacteria 20446
7 JGI25162J39368_1000899 3300002737 Bacteria 19364
8 JGI25157J39369_1012460 3300002741 Bacteria 1081
9 JGI25164J39214_1000963 3300002772 Bacteria 9237
10 JGI25165J46597_1000739 3300003214 Bacteria 25461
11 rootH2_10051744 3300003320 Bacteria 1113
12 rootH2_10056133 3300003320 Bacteria 5627
13 rootH1_10029533 3300003323 Bacteria 26337
14 rootH1_10033715 3300003316 Bacteria 5415
15 rootH1_10033715 3300003323 Bacteria 2049
16 rootH1_10202357 3300003323 Bacteria 1340
17 Ga0065714_10176766 3300005288 Bacteria 980
18 Ga0070680_100007736 3300005336 Bacteria 8191
19 Ga0070660_100350836 3300005339 Bacteria 1215
20 Ga0070659_100196982 3300005366 Bacteria 1657
21 Ga0070663_100034329 3300005455 Bacteria 3513
22 Ga0070681_10000745 3300005458 Bacteria 27011
23 Ga0070679_100008263 3300005530 Bacteria 9791
24 Ga0070679_100398035 3300005530 Bacteria 1323
25 Ga0068853_100059873 3300005539 Bacteria 3290
26 Ga0068855_100000342 3300005563 Bacteria 57870
27 Ga0068855_100011192 3300005563 Bacteria 10834
28 Ga0068855_100035707 3300005563 Bacteria 5921
29 Ga0068857_100070048 3300005577 Bacteria 3123
30 Ga0068854_100083955 3300005578 Bacteria 2356
31 Ga0068856_100020764 3300005614 Bacteria 6382
32 Ga0068856_100568071 3300005614 Bacteria 1155
33 Ga0068856_100686420 3300005614 Bacteria 1044
34 Ga0075366_10000801 3300006195 Bacteria 15034
35 Ga0097621_100681060 3300006237 Bacteria 945
36 Ga0105240_10000200 3300009093 Bacteria 121941
37 Ga0105240_10036278 3300009093 Bacteria 6344
38 Ga0105240_10046849 3300009093 Bacteria 5475
39 Ga0105240_10120121 3300009093 Bacteria 3165
40 Ga0105240_10193664 3300009093 Bacteria 2389
41 Ga0105241_10039240 3300009174 Bacteria 3571
42 Ga0105241_10329409 3300009174 Bacteria 1319
43 Ga0105241_10453556 3300009174 Bacteria 1135
44 Ga0105242_10789214 3300009176 Bacteria 939
45 Ga0105237_10000239 3300009545 Bacteria 78319
46 Ga0105237_10007163 3300009545 Bacteria 12252
47 Ga0105238_10450189 3300009551 Bacteria 1284
48 Ga0105239_10000001 3300010375 Bacteria 617353
49 Ga0105239_10000059 3300010375 Bacteria 155685
50 Ga0105239_10001792 3300010375 Bacteria 28226
51 Ga0105239_10003333 3300010375 Bacteria 19771
52 Ga0105239_10052735 3300010375 Bacteria 4460
53 Ga0105239_10266971 3300010375 Bacteria 1924
54 Ga0157373_10013923 3300013100 Bacteria 5899
55 Ga0157371_10000805 3300013102 Bacteria 35999
56 Ga0157371_10000849 3300013102 Bacteria 34894
57 Ga0157370_10011311 3300013104 Bacteria 9351
58 Ga0157370_10045132 3300013104 Bacteria 4230
59 Ga0157369_10000664 3300013105 Bacteria 44521
60 Ga0157374_10117555 3300013296 Bacteria 2563
61 Ga0163162_10000116 3300013306 Bacteria 70911
62 Ga0163162_10007180 3300013306 Bacteria 10816
63 Ga0163162_10693247 3300013306 Bacteria 1140
64 Ga0163162_11002645 3300013306 Bacteria 944
65 Ga0157372_10000109 3300013307 Bacteria 86749
66 Ga0157372_10008123 3300013307 Bacteria 11158
67 Ga0157375_10015825 3300013308 Bacteria 6759
68 Ga0163161_10182617 3300017792 Bacteria 1609
69 Ga0207427_100066 3300025231 Bacteria 165770
70 Ga0209437_100010 3300025233 Bacteria 838447
71 Ga0209437_100169 3300025233 Bacteria 142584
72 Ga0209026_1004175 3300025250 Bacteria 4417
73 Ga0209148_1012091 3300025254 Bacteria 1586
74 Ga0209129_1006486 3300025258 Bacteria 3762
75 Ga0209233_1000017 3300025261 Bacteria 898076
76 Ga0209455_1001199 3300025272 Bacteria 12381
77 Ga0207647_10000128 3300025904 Bacteria 59284
78 Ga0207705_10184959 3300025909 Bacteria 1574
79 Ga0207654_10018195 3300025911 Bacteria 3684
80 Ga0207707_10024568 3300025912 Bacteria 5274
81 Ga0207695_10000055 3300025913 Bacteria 382776
82 Ga0207695_10040951 3300025913 Bacteria 4961
83 Ga0207695_10061361 3300025913 Bacteria 3885
84 Ga0207695_10188241 3300025913 Bacteria 1982
85 Ga0207671_10002729 3300025914 Bacteria 18463
86 Ga0207671_10048644 3300025914 Bacteria 3138
87 Ga0207660_10027265 3300025917 Bacteria 3896
88 Ga0207652_10219522 3300025921 Bacteria 1713
89 Ga0207644_10014566 3300025931 Bacteria 5263
90 Ga0207690_10141639 3300025932 Bacteria 1772
91 Ga0207669_10354814 3300025937 Bacteria 1134
92 Ga0207667_10000015 3300025949 Bacteria 417534
93 Ga0207667_10003651 3300025949 Bacteria 18976
94 Ga0207667_10007607 3300025949 Bacteria 12985
95 Ga0207667_10310349 3300025949 Bacteria 1611
96 Ga0207667_10433981 3300025949 Bacteria 1336
97 Ga0207640_10039754 3300025981 Bacteria 2980
98 Ga0207639_10018597 3300026041 Bacteria 4941
99 Ga0207678_10116228 3300026067 Bacteria 2282
100 Ga0207702_10055367 3300026078 Bacteria 3363
101 Ga0207702_10555569 3300026078 Bacteria 1123
102 Ga0207674_10257281 3300026116 Bacteria 1693
103 Ga0268266_10000111 3300028379 Bacteria 169743
104 Ga0307515_10001027 3300028794 Bacteria 63746
105 Ga0307515_10002940 3300028794 Bacteria 36133
106 Ga0265338_10336679 3300028800 Bacteria 1088
107 Ga0307513_10620149 3300031456 Bacteria 790
108 Ga0307507_10000036 3300033179 Bacteria 187512
109 Ga0395899_0000001 3300037312 Bacteria 1750322
110 Ga0395899_0003279 3300037312 Bacteria 12831
111 Ga0395900_0000095 3300037418 Bacteria 164383
112 Ga0395900_0000370 3300037418 Bacteria 64745
113 Ga0395900_0085062 3300037418 Bacteria 3251
114 Ga0395898_0051852 3300037466 Bacteria 4010
115 Ga0395905_0000529 3300037471 Bacteria 52320
116 Ga0395901_0000580 3300038443 Bacteria 42442
117 Ga0436361_0269064 3300039447 Bacteria 23413
118 Ga0439448_0017709 3300042005 Bacteria 2177
119 Ga0466969_0057262 3300044656 Bacteria 1900
120 Ga0466958_0039001 3300045836 Bacteria 2852
121 Ga0495651_0144139 3300046462 Bacteria 1724
122 Ga0495585_0000947 3300046492 Bacteria 24468
123 Ga0495606_0000035 3300046507 Bacteria 243820
124 Ga0495606_0045984 3300046507 Bacteria 2888
125 Ga0495606_0076076 3300046507 Bacteria 2099
126 Ga0495616_0029122 3300046513 Bacteria 2918
127 Ga0495631_0182761 3300046518 Bacteria 898
128 Ga0495644_0011103 3300046523 Bacteria 3472
129 Ga0495648_0064124 3300046524 Bacteria 2165
130 Ga0495609_0014957 3300046538 Bacteria 3640
131 Ga0495633_0000027 3300046558 Bacteria 204613
132 Ga0495668_0000112 3300046616 Bacteria 128501
133 Ga0495625_0000785 3300046660 Bacteria 44141
134 Ga0495625_0001065 3300046660 Bacteria 35829
135 Ga0495625_0018343 3300046660 Bacteria 5465
136 Ga0495625_0023222 3300046660 Bacteria 4740
137 Ga0495625_0059299 3300046660 Bacteria 2716
138 Ga0495625_0074570 3300046660 Bacteria 2376
139 Ga0495661_0008288 3300046665 Bacteria 7201
140 Ga0495686_0001369 3300047472 Bacteria 27183
141 Ga0495686_0002549 3300047472 Bacteria 17008
142 Ga0495686_0008395 3300047472 Bacteria 7579
143 Ga0495614_0016408 3300048089 Bacteria 3223
144 Ga0495678_009955 3300049459 Bacteria 4656
145 nmdc:mga0k408_1074_c1 3300050493 Bacteria 15034
146 nmdc:mga0k408_1340_c1 3300050493 Bacteria 13307
147 Ga0500635_0000314 3300053080 Bacteria 16905
148 Ga0500608_088076 3300053122 Bacteria 1455
149 Ga0500618_000012 3300053125 Bacteria 185382
150 Ga0500642_0044235 3300053130 Bacteria 1938
151 Ga0500564_027920 3300053138 Bacteria 2599
152 Ga0500579_113236 3300053143 Bacteria 1354
153 Ga0500616_0028434 3300053153 Bacteria 3081
154 Ga0500622_0003214 3300053156 Bacteria 11110
155 Ga0500624_000368 3300053157 Bacteria 14523
156 2852624638 2852623160 Bacteria 4376875
157 2884936478 2884933994 Bacteria 4535041
158 2919438434 2919437846 Bacteria 6199444
159 2977236378 2977232053 Bacteria 5485925
160 Ga0207671_10011083
161 JGI24740J21852_10018922
162 JGI24737J22298_10003858
163 JGI24735J21928_10005118
164 JGI25162J39368_1000059
165 JGI25162J39368_1000823
166 JGI25162J39368_1000899
167 JGI25157J39369_1012460
168 JGI25164J39214_1000963
169 JGI25165J46597_1000739
170 rootH2_10051744
171 rootH2_10056133
172 rootH1_10029533
173 rootH1_10033715
174 rootH1_10202357
175 Ga0065714_10176766
176 Ga0070680_100007736
177 Ga0070660_100350836
178 Ga0070659_100196982
179 Ga0070663_100034329
180 Ga0070681_10000745
181 Ga0070679_100008263
182 Ga0070679_100398035
183 Ga0068853_100059873
184 Ga0068855_100000342
185 Ga0068855_100011192
186 Ga0068855_100035707
187 Ga0068857_100070048
188 Ga0068854_100083955
189 Ga0068856_100020764
190 Ga0068856_100568071
191 Ga0068856_100686420
192 Ga0075366_10000801
193 Ga0097621_100681060
194 Ga0105240_10000200
195 Ga0105240_10036278
196 Ga0105240_10046849
197 Ga0105240_10120121
198 Ga0105240_10193664
199 Ga0105241_10039240
200 Ga0105241_10329409
201 Ga0105241_10453556
202 Ga0105242_10789214
203 Ga0105237_10000239
204 Ga0105237_10007163
205 Ga0105238_10450189
206 Ga0105239_10000001
207 Ga0105239_10000059
208 Ga0105239_10001792
209 Ga0105239_10003333
210 Ga0105239_10052735
211 Ga0105239_10266971
212 Ga0157373_10013923
213 Ga0157371_10000805
214 Ga0157371_10000849
215 Ga0157370_10011311
216 Ga0157370_10045132
217 Ga0157369_10000664
218 Ga0157374_10117555
219 Ga0163162_10000116
220 Ga0163162_10007180
221 Ga0163162_10693247
222 Ga0163162_11002645
223 Ga0157372_10000109
224 Ga0157372_10008123
225 Ga0157375_10015825
226 Ga0163161_10182617
227 Ga0207427_100066
228 Ga0209437_100010
229 Ga0209437_100169
230 Ga0209026_1004175
231 Ga0209148_1012091
232 Ga0209129_1006486
233 Ga0209233_1000017
234 Ga0209455_1001199
235 Ga0207647_10000128
236 Ga0207705_10184959
237 Ga0207654_10018195
238 Ga0207707_10024568
239 Ga0207695_10000055
240 Ga0207695_10040951
241 Ga0207695_10061361
242 Ga0207695_10188241
243 Ga0207671_10002729
244 Ga0207671_10048644
245 Ga0207660_10027265
246 Ga0207652_10219522
247 Ga0207644_10014566
248 Ga0207690_10141639
249 Ga0207669_10354814
250 Ga0207667_10000015
251 Ga0207667_10003651
252 Ga0207667_10007607
253 Ga0207667_10310349
254 Ga0207667_10433981
255 Ga0207640_10039754
256 Ga0207639_10018597
257 Ga0207678_10116228
258 Ga0207702_10055367
259 Ga0207702_10555569
260 Ga0207674_10257281
261 Ga0268266_10000111
262 Ga0307515_10001027
263 Ga0307515_10002940
264 Ga0265338_10336679
265 Ga0307513_10620149
266 Ga0307507_10000036
267 Ga0395899_0000001
268 Ga0395899_0003279
269 Ga0395900_0000095
270 Ga0395900_0000370
271 Ga0395900_0085062
272 Ga0395898_0051852
273 Ga0395905_0000529
274 Ga0395901_0000580
275 Ga0436361_0269064
276 Ga0439448_0017709
277 Ga0466969_0057262
278 Ga0466958_0039001
279 Ga0495651_0144139
280 Ga0495585_0000947
281 Ga0495606_0000035
282 Ga0495606_0045984
283 Ga0495606_0076076
284 Ga0495616_0029122
285 Ga0495631_0182761
286 Ga0495644_0011103
287 Ga0495648_0064124
288 Ga0495609_0014957
289 Ga0495633_0000027
290 Ga0495668_0000112
291 Ga0495625_0000785
292 Ga0495625_0001065
293 Ga0495625_0018343
294 Ga0495625_0023222
295 Ga0495625_0059299
296 Ga0495625_0074570
297 Ga0495661_0008288
298 Ga0495686_0001369
299 Ga0495686_0002549
300 Ga0495686_0008395
301 Ga0495614_0016408
302 Ga0495678_009955
303 nmdc:mga0k408_1074_c1
304 nmdc:mga0k408_1340_c1
305 Ga0500635_0000314
306 Ga0500608_088076
307 Ga0500618_000012
308 Ga0500642_0044235
309 Ga0500564_027920
310 Ga0500579_113236
311 Ga0500616_0028434
312 Ga0500622_0003214
313 Ga0500624_000368
314 2852624638
315 2884936478
316 2919438434
317 2977236378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dy4-assembly2.cif.gz_G high resolution crystal structure of hemoglobin m boston. 0.3555 80 209
2w72-assembly1.cif.gz_C deoxygenated structure of a distal site hemoglobin mutant plus xe 0.3551 80 209
6kai-assembly2.cif.gz_E crosslinked alpha(ni)-beta(fe) human hemoglobin a in the t quaternary structure at 95 k: light 0.3534 80 209
1v4x-assembly1.cif.gz_A crystal structure of bluefin tuna hemoglobin deoxy form at ph5.0 0.352 104 209
1out-assembly1.cif.gz_A trout hemoglobin i 0.3517 80 209
ID Description Score Start End Superfamily
af_Q7FB56_1_199_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.3727 60 226 1.20.1560.10
1hdaD00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3545 85 208 1.10.490.10
af_O43008_86_182_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3534 62 151 1.10.472.10
1spgA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3484 104 209 1.10.490.10
5kerH00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3475 80 208 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A554SM20-F1-model_v4 deleted 0.9927 1 220
AF-A0A4Q3ENN0-F1-model_v4 DUF479 domain-containing protein 0.9842 1 222
AF-A0A4U1GMN9-F1-model_v4 DUF479 domain-containing protein 0.9801 1 221
AF-A0A4Q3ENN0-F1-model_v4 DUF479 domain-containing protein 0.9798 1 222
AF-A0A4V1T2D9-F1-model_v4 DUF479 domain-containing protein 0.9789 1 162

Map