F230445

General Info

Members Datasets Scaffolds Average Seq Length
158 115 316 262

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0000280|Ga0495630_0000280_12520_13395
Length 291
Sequence MNTPAAPRQAPLERRLIFAMGGGGFTMEPANPLLDDFVLSLAPPRASAATREPRILFLPTASGDTTAQIAAFHARFADRHCVAEHLSLFRLHELRRPLGEIVLSQDVLYVGGGSMRNLLAIWRTHDLDRLLICAWRRGIVLAGISAGAMCWFEGGITRSSGRPEPLSGLGLLPGSLTVHADGEPERLPVWLAAIREGVLPGGWSLDDGVGLLFAGTRLRRIVSSRPGASAQRVDQVAGELVRNRLAPELLGERGAPRLHSPLDDDVQELRRVQRLRRAVSGPRGGRLGGHW

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
75 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 18.99
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0000280 3300046517 Bacteria 41276
2 Ga0070683_100168683 3300005329 Bacteria 2077
3 Ga0068868_100284348 3300005338 Bacteria 1401
4 Ga0070660_100021821 3300005339 Bacteria 4727
5 Ga0070692_10092022 3300005345 Bacteria 1650
6 Ga0070669_100023689 3300005353 Bacteria 4398
7 Ga0070673_100400174 3300005364 Bacteria 1228
8 Ga0070659_100000002 3300005366 Bacteria 369239
9 Ga0070667_100591409 3300005367 Bacteria 1022
10 Ga0070714_100000019 3300005435 Bacteria 169455
11 Ga0070714_100003420 3300005435 Bacteria 11825
12 Ga0070714_100030746 3300005435 Bacteria 4473
13 Ga0070714_100202582 3300005435 Bacteria 1816
14 Ga0070710_10000006 3300005437 Bacteria 217422
15 Ga0070711_100095850 3300005439 Bacteria 2148
16 Ga0070711_100251406 3300005439 Bacteria 1387
17 Ga0070705_100000619 3300005440 Bacteria 20518
18 Ga0070700_100011214 3300005441 Bacteria 4962
19 Ga0068867_100493695 3300005459 Bacteria 1051
20 Ga0070707_100298009 3300005468 Bacteria 1567
21 Ga0070684_100097147 3300005535 Bacteria 2626
22 Ga0070672_100203669 3300005543 Bacteria 1655
23 Ga0070665_100005506 3300005548 Bacteria 13035
24 Ga0070664_100052963 3300005564 Bacteria 3439
25 Ga0068856_100176970 3300005614 Bacteria 2146
26 Ga0068861_100786993 3300005719 Bacteria 891
27 Ga0081455_10034585 3300005937 Bacteria 4526
28 Ga0081539_10003961 3300005985 Bacteria 17144
29 Ga0081539_10009349 3300005985 Bacteria 8222
30 Ga0070717_10000005 3300006028 Bacteria 357819
31 Ga0070715_10073029 3300006163 Bacteria 1537
32 Ga0070712_100000007 3300006175 Bacteria 157653
33 Ga0105240_10003866 3300009093 Bacteria 23134
34 Ga0105245_10122805 3300009098 Bacteria 2427
35 Ga0105243_10261186 3300009148 Bacteria 1550
36 Ga0105239_10033106 3300010375 Bacteria 5677
37 Ga0157369_10607119 3300013105 Bacteria 1129
38 Ga0163162_10679173 3300013306 Bacteria 1152
39 Ga0157375_10473258 3300013308 Bacteria 1418
40 Ga0163163_10561298 3300014325 Bacteria 1204
41 Ga0157380_10011638 3300014326 Bacteria 6360
42 Ga0157379_10005485 3300014968 Bacteria 10887
43 Ga0157379_10257426 3300014968 Bacteria 1585
44 Ga0163161_10515257 3300017792 Bacteria 976
45 Ga0207692_10000001 3300025898 Bacteria 558345
46 Ga0207642_10284634 3300025899 Bacteria 952
47 Ga0207688_10093980 3300025901 Bacteria 1725
48 Ga0207693_10000001 3300025915 Bacteria 469535
49 Ga0207693_10162422 3300025915 Bacteria 1758
50 Ga0207663_10005122 3300025916 Bacteria 6589
51 Ga0207663_10171476 3300025916 Bacteria 1541
52 Ga0207657_10044648 3300025919 Bacteria 3894
53 Ga0207652_10409240 3300025921 Bacteria 1224
54 Ga0207646_10226708 3300025922 Bacteria 1688
55 Ga0207681_10018190 3300025923 Bacteria 4425
56 Ga0207664_10000008 3300025929 Bacteria 309301
57 Ga0207664_10000529 3300025929 Bacteria 27133
58 Ga0207664_10012473 3300025929 Bacteria 6078
59 Ga0207664_10266376 3300025929 Bacteria 1500
60 Ga0207664_10440624 3300025929 Unclassified 1162
61 Ga0207664_10507076 3300025929 Bacteria 1081
62 Ga0207690_10000088 3300025932 Bacteria 76762
63 Ga0207669_10271177 3300025937 Bacteria 1275
64 Ga0207665_10107391 3300025939 Bacteria 1957
65 Ga0207691_10060989 3300025940 Bacteria 3426
66 Ga0207679_10036076 3300025945 Bacteria 3504
67 Ga0207708_10104488 3300026075 Bacteria 2195
68 Ga0207702_10137163 3300026078 Bacteria 2209
69 Ga0207648_10097874 3300026089 Bacteria 2568
70 Ga0207675_100065752 3300026118 Bacteria 3389
71 Ga0268266_10124812 3300028379 Bacteria 2295
72 Ga0268266_10197221 3300028379 Bacteria 1841
73 Ga0265326_10000003 3300028558 Bacteria 479811
74 Ga0265334_10000217 3300028573 Bacteria 33112
75 Ga0265336_10006018 3300028666 Bacteria 4415
76 Ga0265338_10000844 3300028800 Bacteria 51666
77 Ga0265338_10012459 3300028800 Bacteria 9693
78 Ga0265324_10001900 3300029957 Bacteria 11228
79 Ga0265327_10003020 3300031251 Bacteria 16677
80 Ga0265327_10040653 3300031251 Bacteria 2513
81 Ga0265327_10170068 3300031251 Bacteria 1002
82 Ga0307410_10420311 3300031852 Bacteria 1084
83 Ga0307409_100131851 3300031995 Bacteria 2137
84 Ga0307409_100147309 3300031995 Bacteria 2038
85 Ga0373935_0143470 3300035692 Bacteria 1615
86 Ga0373947_0054495 3300035725 Bacteria 2413
87 Ga0373947_0315387 3300035725 Bacteria 1045
88 Ga0395899_0117375 3300037312 Bacteria 1909
89 Ga0395900_0073801 3300037418 Bacteria 3508
90 Ga0395900_0510717 3300037418 Bacteria 1151
91 Ga0395898_0094140 3300037466 Bacteria 2879
92 Ga0395898_0285116 3300037466 Bacteria 1575
93 Ga0395905_0058819 3300037471 Bacteria 3594
94 Ga0395901_0022413 3300038443 Bacteria 6472
95 Ga0395901_0065216 3300038443 Bacteria 3791
96 Ga0395901_0100443 3300038443 Bacteria 3035
97 Ga0395901_0193665 3300038443 Bacteria 2132
98 Ga0439463_032210 3300042016 Bacteria 1324
99 Ga0450902_028760 3300042137 Bacteria 933
100 Ga0466960_0000064 3300044901 Bacteria 35453
101 Ga0466958_0231365 3300045836 Bacteria 1180
102 Ga0466967_0240250 3300045976 Bacteria 1728
103 Ga0495592_0432261 3300046454 Unclassified 828
104 Ga0495653_0000582 3300046463 Bacteria 28064
105 Ga0495653_0302970 3300046463 Bacteria 1042
106 Ga0495650_0000053 3300046471 Bacteria 316684
107 Ga0495582_0119872 3300046473 Bacteria 1482
108 Ga0495664_0000032 3300046477 Bacteria 85909
109 Ga0495618_0000137 3300046514 Bacteria 52421
110 Ga0495652_0118726 3300046529 Bacteria 2113
111 Ga0495645_0000022 3300046543 Bacteria 137019
112 Ga0495645_0000561 3300046543 Bacteria 25512
113 Ga0495657_0000041 3300046675 Bacteria 115251
114 Ga0495604_0000158 3300047317 Bacteria 59386
115 Ga0495672_0028736 3300047320 Bacteria 3512
116 Ga0495672_0030883 3300047320 Bacteria 3352
117 Ga0495676_0028581 3300047321 Bacteria 4759
118 Ga0496100_0010425 3300048903 Bacteria 5259
119 Ga0496100_0011865 3300048903 Bacteria 4974
120 Ga0496101_0031065 3300048904 Bacteria 3752
121 Ga0496101_0111120 3300048904 Bacteria 2063
122 Ga0496102_0000002 3300048905 Bacteria 814588
123 Ga0496102_0326633 3300048905 Bacteria 1445
124 Ga0496102_0422782 3300048905 Bacteria 1252
125 Ga0496103_0000218 3300048906 Bacteria 56596
126 Ga0496103_0235432 3300048906 Bacteria 1178
127 Ga0496104_0000006 3300048907 Bacteria 536446
128 Ga0496105_0005573 3300048908 Bacteria 9561
129 Ga0496106_0001792 3300048909 Bacteria 16049
130 Ga0496108_0009387 3300048911 Bacteria 7921
131 Ga0496108_0066125 3300048911 Bacteria 3048
132 Ga0496108_0527930 3300048911 Bacteria 1030
133 Ga0496109_0047081 3300048912 Bacteria 3919
134 Ga0496109_0305302 3300048912 Bacteria 1501
135 Ga0496110_0000156 3300048913 Bacteria 41321
136 Ga0496110_0016965 3300048913 Bacteria 6087
137 Ga0496111_0000196 3300048914 Bacteria 28066
138 Ga0496111_0046676 3300048914 Bacteria 3119
139 Ga0496111_0073969 3300048914 Bacteria 2481
140 Ga0496112_0000223 3300048915 Bacteria 36875
141 Ga0496112_0009702 3300048915 Bacteria 8691
142 Ga0496112_0031653 3300048915 Bacteria 5132
143 Ga0496112_0040461 3300048915 Bacteria 4557
144 Ga0496112_0468301 3300048915 Bacteria 1197
145 Ga0496113_0021542 3300048916 Bacteria 4548
146 Ga0496115_0000053 3300048918 Bacteria 106425
147 Ga0496115_0003897 3300048918 Bacteria 10750
148 Ga0496124_0071589 3300048927 Bacteria 2873
149 Ga0501034_0009909 3300049571 Bacteria 9956
150 Ga0501068_0302898 3300049584 Bacteria 1023
151 Ga0501080_0105752 3300049742 Bacteria 2609
152 nmdc:mga09592_477530_c1 3300050508 Bacteria 1074
153 nmdc:mga08y16_142089_c1 3300050511 Bacteria 2495
154 nmdc:mga0a205_304390_c1 3300050515 Bacteria 1466
155 Ga0495601_0023757 3300053077 Bacteria 3769
156 Ga0495612_0000117 3300053078 Bacteria 33431
157 Ga0495619_0158195 3300053085 Bacteria 1564
158 Ga0500572_070045 3300053111 Bacteria 1082
159 Ga0495630_0000280
160 Ga0070683_100168683
161 Ga0068868_100284348
162 Ga0070660_100021821
163 Ga0070692_10092022
164 Ga0070669_100023689
165 Ga0070673_100400174
166 Ga0070659_100000002
167 Ga0070667_100591409
168 Ga0070714_100000019
169 Ga0070714_100003420
170 Ga0070714_100030746
171 Ga0070714_100202582
172 Ga0070710_10000006
173 Ga0070711_100095850
174 Ga0070711_100251406
175 Ga0070705_100000619
176 Ga0070700_100011214
177 Ga0068867_100493695
178 Ga0070707_100298009
179 Ga0070684_100097147
180 Ga0070672_100203669
181 Ga0070665_100005506
182 Ga0070664_100052963
183 Ga0068856_100176970
184 Ga0068861_100786993
185 Ga0081455_10034585
186 Ga0081539_10003961
187 Ga0081539_10009349
188 Ga0070717_10000005
189 Ga0070715_10073029
190 Ga0070712_100000007
191 Ga0105240_10003866
192 Ga0105245_10122805
193 Ga0105243_10261186
194 Ga0105239_10033106
195 Ga0157369_10607119
196 Ga0163162_10679173
197 Ga0157375_10473258
198 Ga0163163_10561298
199 Ga0157380_10011638
200 Ga0157379_10005485
201 Ga0157379_10257426
202 Ga0163161_10515257
203 Ga0207692_10000001
204 Ga0207642_10284634
205 Ga0207688_10093980
206 Ga0207693_10000001
207 Ga0207693_10162422
208 Ga0207663_10005122
209 Ga0207663_10171476
210 Ga0207657_10044648
211 Ga0207652_10409240
212 Ga0207646_10226708
213 Ga0207681_10018190
214 Ga0207664_10000008
215 Ga0207664_10000529
216 Ga0207664_10012473
217 Ga0207664_10266376
218 Ga0207664_10440624
219 Ga0207664_10507076
220 Ga0207690_10000088
221 Ga0207669_10271177
222 Ga0207665_10107391
223 Ga0207691_10060989
224 Ga0207679_10036076
225 Ga0207708_10104488
226 Ga0207702_10137163
227 Ga0207648_10097874
228 Ga0207675_100065752
229 Ga0268266_10124812
230 Ga0268266_10197221
231 Ga0265326_10000003
232 Ga0265334_10000217
233 Ga0265336_10006018
234 Ga0265338_10000844
235 Ga0265338_10012459
236 Ga0265324_10001900
237 Ga0265327_10003020
238 Ga0265327_10040653
239 Ga0265327_10170068
240 Ga0307410_10420311
241 Ga0307409_100131851
242 Ga0307409_100147309
243 Ga0373935_0143470
244 Ga0373947_0054495
245 Ga0373947_0315387
246 Ga0395899_0117375
247 Ga0395900_0073801
248 Ga0395900_0510717
249 Ga0395898_0094140
250 Ga0395898_0285116
251 Ga0395905_0058819
252 Ga0395901_0022413
253 Ga0395901_0065216
254 Ga0395901_0100443
255 Ga0395901_0193665
256 Ga0439463_032210
257 Ga0450902_028760
258 Ga0466960_0000064
259 Ga0466958_0231365
260 Ga0466967_0240250
261 Ga0495592_0432261
262 Ga0495653_0000582
263 Ga0495653_0302970
264 Ga0495650_0000053
265 Ga0495582_0119872
266 Ga0495664_0000032
267 Ga0495618_0000137
268 Ga0495652_0118726
269 Ga0495645_0000022
270 Ga0495645_0000561
271 Ga0495657_0000041
272 Ga0495604_0000158
273 Ga0495672_0028736
274 Ga0495672_0030883
275 Ga0495676_0028581
276 Ga0496100_0010425
277 Ga0496100_0011865
278 Ga0496101_0031065
279 Ga0496101_0111120
280 Ga0496102_0000002
281 Ga0496102_0326633
282 Ga0496102_0422782
283 Ga0496103_0000218
284 Ga0496103_0235432
285 Ga0496104_0000006
286 Ga0496105_0005573
287 Ga0496106_0001792
288 Ga0496108_0009387
289 Ga0496108_0066125
290 Ga0496108_0527930
291 Ga0496109_0047081
292 Ga0496109_0305302
293 Ga0496110_0000156
294 Ga0496110_0016965
295 Ga0496111_0000196
296 Ga0496111_0046676
297 Ga0496111_0073969
298 Ga0496112_0000223
299 Ga0496112_0009702
300 Ga0496112_0031653
301 Ga0496112_0040461
302 Ga0496112_0468301
303 Ga0496113_0021542
304 Ga0496115_0000053
305 Ga0496115_0003897
306 Ga0496124_0071589
307 Ga0501034_0009909
308 Ga0501068_0302898
309 Ga0501080_0105752
310 nmdc:mga09592_477530_c1
311 nmdc:mga08y16_142089_c1
312 nmdc:mga0a205_304390_c1
313 Ga0495601_0023757
314 Ga0495612_0000117
315 Ga0495619_0158195
316 Ga0500572_070045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

17

221

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqw-assembly1.cif.gz_A pcc6803 cyanophycinase s132dap covalently bound to cyanophycin dimer 0.8018 1 223
3en0-assembly1.cif.gz_B the structure of cyanophycinase 0.7864 1 223
7c9b-assembly1.cif.gz_A-2 crystal structure of dipeptidase-e from xenopus laevis 0.7855 3 226
3en0-assembly2.cif.gz_C-2 the structure of cyanophycinase 0.7853 1 223
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.769 1 223
ID Description Score Start End Superfamily
af_Q4DS63_13_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8585 18 218 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7775 15 222 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7715 1 223 3.40.50.880
1fyeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.749 15 225 3.40.50.880
af_I1M0Q0_10_171_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7228 28 118 3.40.50.10140
ID Description Score Start End GO Terms
AF-A0A7W1K9F6-F1-model_v4 Peptidase E 0.9862 1 205 GO:0006508
GO:0008236
AF-A0A7V8ZIA9-F1-model_v4 Peptidase E 0.9822 1 225 GO:0006508
GO:0008236
AF-A0A1G6UJI3-F1-model_v4 Peptidase family S51 0.9772 78 226 GO:0006508
GO:0008236
AF-A0A542GVW8-F1-model_v4 deleted 0.973 1 226
AF-A0A2W5MGH5-F1-model_v4 deleted 0.9709 92 225

Map