F232128

General Info

Members Datasets Scaffolds Average Seq Length
159 124 318 252

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10063715|Ga0099796_100637151
Length 284
Sequence MLRNFGSDTGNIFAVWIWKFPLTIRKDHNYMKITGNTILITGGGSGIGRGLAESFHSLGNQVIIAGRRKQALDETTSKNAGMTSLALDIEDPAAIRSFASQVTARFPKLNVLVNNAGIMRVENLQAQQGDLADAESIIATNLLGPIRLTAALLPLLQKQAHSTIMNVSSGLAFVPLAYTPTYCATKAAVHSYTQSLRFQLRSSTTEVLELIPPYVATNLLNGASDPRAMPLDAYIAEVMGILKTQPGASEICVERVKNLRFAAESGKYEDFFRTFNEAMEIDPH

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
111 2643221584 Caulobacter sp. Root656 Isolate Unclassified
112 2643221734 Bosea sp. Root670 Isolate Unclassified
113 2734482264 Dyella sp. AD052 Isolate Unclassified
114 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
115 2818991467 Bosea vestrisii 3192 Isolate Unclassified
116 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
117 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
118 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
119 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
120 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
121 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
122 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
123 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
124 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 0
Isolates 9.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.75
Nodule 3.14
Rhizoplane 0.63
Rhizosphere 61.64
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10063715 3300010159 Bacteria 1313
2 JGI25150J39212_1001116 3300002774 Bacteria 8082
3 JGI25151J46595_10000028 3300003187 Bacteria 208373
4 JGI25153J46596_10000044 3300003215 Bacteria 154263
5 rootH1_10123766 3300003316 Bacteria 1019
6 rootL2_10246624 3300003322 Bacteria 1116
7 rootH1_10253977 3300003323 Bacteria 1278
8 Ga0055526_1000333 3300003771 Bacteria 39007
9 Ga0055526_1000648 3300003771 Bacteria 27029
10 Ga0055526_1001015 3300003771 Bacteria 20581
11 Ga0055537_1003135 3300003773 Bacteria 5185
12 Ga0055524_1000020 3300003775 Bacteria 227971
13 Ga0055524_1007444 3300003775 Bacteria 4645
14 Ga0070658_10031889 3300005327 Bacteria 4234
15 Ga0070658_10250093 3300005327 Bacteria 1504
16 Ga0070689_100001333 3300005340 Bacteria 15704
17 Ga0070687_100025888 3300005343 Bacteria 2819
18 Ga0070688_100000192 3300005365 Bacteria 32260
19 Ga0070709_10047528 3300005434 Unclassified 2674
20 Ga0070714_100020183 3300005435 Bacteria 5438
21 Ga0070711_100047554 3300005439 Bacteria 2930
22 Ga0070665_100075311 3300005548 Bacteria 3382
23 Ga0068855_100045519 3300005563 Bacteria 5190
24 Ga0068856_100031445 3300005614 Bacteria 5193
25 Ga0068852_100495184 3300005616 Bacteria 1216
26 Ga0068864_100145778 3300005618 Bacteria 2140
27 Ga0068863_100180159 3300005841 Bacteria 2028
28 Ga0068862_100505874 3300005844 Bacteria 1147
29 Ga0070717_10154817 3300006028 Bacteria 1985
30 Ga0075365_10488727 3300006038 Bacteria 870
31 Ga0075369_10086273 3300006186 Bacteria 1397
32 Ga0099794_10061052 3300007265 Bacteria 1831
33 Ga0099795_10009218 3300007788 Bacteria 2854
34 Ga0105240_10029277 3300009093 Bacteria 7179
35 Ga0105240_10106768 3300009093 Bacteria 3395
36 Ga0105248_10003808 3300009177 Bacteria 16728
37 Ga0105237_10449553 3300009545 Bacteria 1294
38 Ga0157370_10017690 3300013104 Bacteria 7186
39 Ga0157369_10005326 3300013105 Bacteria 14987
40 Ga0171462_1032 3300013250 Bacteria 98473
41 Ga0157372_10204523 3300013307 Bacteria 2288
42 Ga0163161_10622858 3300017792 Bacteria 892
43 Ga0207425_1000026 3300025245 Bacteria 301303
44 Ga0209129_1001127 3300025258 Bacteria 15522
45 Ga0209565_1000064 3300025263 Bacteria 180732
46 Ga0209673_1016473 3300025273 Bacteria 2762
47 Ga0209025_1000008 3300025294 Bacteria 1130876
48 Ga0209025_1000551 3300025294 Bacteria 69956
49 Ga0209564_1000049 3300025295 Bacteria 362075
50 Ga0209564_1000065 3300025295 Bacteria 315205
51 Ga0209564_1001989 3300025295 Bacteria 17896
52 Ga0209564_1006159 3300025295 Bacteria 6569
53 Ga0209758_1000004 3300025297 Bacteria 1375322
54 Ga0209050_1007490 3300025298 Bacteria 6107
55 Ga0209256_1000014 3300025299 Bacteria 687409
56 Ga0209256_1000200 3300025299 Bacteria 112931
57 Ga0207680_10368143 3300025903 Bacteria 1011
58 Ga0207647_10067739 3300025904 Bacteria 2162
59 Ga0207695_10022631 3300025913 Bacteria 7125
60 Ga0207695_10074092 3300025913 Bacteria 3466
61 Ga0207663_10063071 3300025916 Unclassified 2358
62 Ga0207700_10024453 3300025928 Bacteria 4180
63 Ga0207664_10161316 3300025929 Bacteria 1912
64 Ga0207670_10000241 3300025936 Bacteria 34491
65 Ga0207711_10001880 3300025941 Bacteria 19134
66 Ga0207667_10008314 3300025949 Bacteria 12345
67 Ga0207702_10042575 3300026078 Bacteria 3810
68 Ga0207698_10214955 3300026142 Bacteria 1733
69 Ga0209371_1029165 3300027312 Bacteria 1222
70 Ga0209371_1029168 3300027312 Bacteria 1222
71 Ga0268266_10359202 3300028379 Bacteria 1370
72 Ga0265318_10090362 3300028577 Bacteria 1128
73 Ga0265336_10010819 3300028666 Bacteria 3117
74 Ga0265338_10001905 3300028800 Bacteria 32594
75 Ga0265338_10009615 3300028800 Bacteria 11487
76 Ga0265338_10085199 3300028800 Bacteria 2635
77 Ga0265324_10011890 3300029957 Bacteria 3304
78 Ga0268256_1033446 3300030500 Bacteria 1214
79 Ga0268256_1034807 3300030500 Bacteria 1176
80 Ga0265330_10016454 3300031235 Bacteria 3412
81 Ga0265332_10010051 3300031238 Bacteria 4214
82 Ga0265332_10019183 3300031238 Bacteria 3019
83 Ga0265328_10013758 3300031239 Bacteria 3196
84 Ga0265320_10002053 3300031240 Bacteria 14183
85 Ga0265325_10057722 3300031241 Bacteria 1979
86 Ga0265325_10091130 3300031241 Bacteria 1503
87 Ga0265325_10145411 3300031241 Bacteria 1125
88 Ga0265329_10024984 3300031242 Bacteria 1980
89 Ga0265340_10004524 3300031247 Bacteria 7756
90 Ga0265340_10082501 3300031247 Bacteria 1512
91 Ga0265339_10005230 3300031249 Bacteria 8676
92 Ga0265339_10023284 3300031249 Bacteria 3583
93 Ga0265339_10089019 3300031249 Bacteria 1620
94 Ga0265331_10001121 3300031250 Bacteria 20536
95 Ga0265327_10109549 3300031251 Eukaryota 1322
96 Ga0265316_10003132 3300031344 Bacteria 16845
97 Ga0265316_10003728 3300031344 Bacteria 15329
98 Ga0265316_10095354 3300031344 Bacteria 2266
99 Ga0265316_10098322 3300031344 Bacteria 2227
100 Ga0265316_10305356 3300031344 Bacteria 1158
101 Ga0307513_10041595 3300031456 Bacteria 5070
102 Ga0265314_10003033 3300031711 Bacteria 16589
103 Ga0265342_10079703 3300031712 Bacteria 1893
104 Ga0307412_10007282 3300031911 Bacteria 6274
105 Ga0307414_10337658 3300032004 Bacteria 1288
106 Ga0373946_0179814 3300035171 Bacteria 1003
107 Ga0373935_0030041 3300035692 Bacteria 3366
108 Ga0373927_0005887 3300035695 Bacteria 8400
109 Ga0373947_0000142 3300035725 Bacteria 37230
110 Ga0373925_0000221 3300037068 Bacteria 60956
111 Ga0495606_0071441 3300046507 Bacteria 2185
112 Ga0495632_0168921 3300046519 Bacteria 1005
113 Ga0495643_0049484 3300046522 Bacteria 2267
114 Ga0495668_0024001 3300046616 Bacteria 3471
115 Ga0495668_0058207 3300046616 Bacteria 2133
116 Ga0495624_0123186 3300046690 Bacteria 1592
117 Ga0495670_0037048 3300046691 Bacteria 2431
118 Ga0495649_0000444 3300046694 Bacteria 35791
119 Ga0495649_0039974 3300046694 Bacteria 2570
120 Ga0495687_031443 3300047443 Bacteria 2435
121 Ga0495686_0001036 3300047472 Bacteria 33364
122 Ga0495686_0012324 3300047472 Bacteria 5985
123 Ga0496115_0000988 3300048918 Bacteria 20593
124 Ga0496116_0054215 3300048919 Bacteria 2643
125 Ga0496122_0069228 3300048925 Bacteria 2528
126 Ga0496123_0047785 3300048926 Bacteria 2886
127 Ga0496123_0097013 3300048926 Bacteria 1728
128 Ga0496125_0003591 3300048928 Bacteria 18645
129 Ga0496125_0038952 3300048928 Bacteria 4103
130 Ga0496125_0062764 3300048928 Bacteria 2968
131 Ga0496125_0077419 3300048928 Bacteria 2564
132 Ga0496126_0173808 3300048929 Bacteria 1833
133 Ga0496126_0220577 3300048929 Bacteria 1593
134 Ga0495682_0122234 3300049460 Bacteria 932
135 Ga0501034_0381162 3300049571 Bacteria 1335
136 Ga0501037_0146937 3300049573 Bacteria 1686
137 nmdc:mga00v17_159698_c1 3300050491 Bacteria 1450
138 Ga0500578_0046651 3300053086 Bacteria 2780
139 Ga0500643_005734 3300053087 Bacteria 5298
140 Ga0500655_025335 3300053133 Bacteria 1125
141 Ga0500573_0049348 3300053140 Bacteria 2422
142 Ga0500616_0000011 3300053153 Bacteria 732880
143 Ga0500616_0027636 3300053153 Bacteria 3131
144 Ga0500616_0084037 3300053153 Bacteria 1593
145 2643781539 2643221552 Bacteria 5708754
146 2643928982 2643221584 Bacteria 5511711
147 2644734988 2643221734 Bacteria 5365412
148 2735837330 2734482264 Unclassified 5014763
149 2753766632 2751185897 Bacteria 5322941
150 2819719541 2818991467 Bacteria 5893227
151 2821449851 2821443989 Bacteria 7658172
152 2842112488 2842110456 Bacteria 7656360
153 2842486801 2842482326 Bacteria 7212537
154 2857521932 2857516855 Bacteria 7787325
155 2917704780 2917699015 Bacteria 7043791
156 2933588623 2933586486 Bacteria 7667493
157 2936377395 2936375103 Bacteria 6652732
158 2939603263 2939602548 Bacteria 4950493
159 8005377762 8005376324 Bacteria 6590079
160 Ga0099796_10063715
161 JGI25150J39212_1001116
162 JGI25151J46595_10000028
163 JGI25153J46596_10000044
164 rootH1_10123766
165 rootL2_10246624
166 rootH1_10253977
167 Ga0055526_1000333
168 Ga0055526_1000648
169 Ga0055526_1001015
170 Ga0055537_1003135
171 Ga0055524_1000020
172 Ga0055524_1007444
173 Ga0070658_10031889
174 Ga0070658_10250093
175 Ga0070689_100001333
176 Ga0070687_100025888
177 Ga0070688_100000192
178 Ga0070709_10047528
179 Ga0070714_100020183
180 Ga0070711_100047554
181 Ga0070665_100075311
182 Ga0068855_100045519
183 Ga0068856_100031445
184 Ga0068852_100495184
185 Ga0068864_100145778
186 Ga0068863_100180159
187 Ga0068862_100505874
188 Ga0070717_10154817
189 Ga0075365_10488727
190 Ga0075369_10086273
191 Ga0099794_10061052
192 Ga0099795_10009218
193 Ga0105240_10029277
194 Ga0105240_10106768
195 Ga0105248_10003808
196 Ga0105237_10449553
197 Ga0157370_10017690
198 Ga0157369_10005326
199 Ga0171462_1032
200 Ga0157372_10204523
201 Ga0163161_10622858
202 Ga0207425_1000026
203 Ga0209129_1001127
204 Ga0209565_1000064
205 Ga0209673_1016473
206 Ga0209025_1000008
207 Ga0209025_1000551
208 Ga0209564_1000049
209 Ga0209564_1000065
210 Ga0209564_1001989
211 Ga0209564_1006159
212 Ga0209758_1000004
213 Ga0209050_1007490
214 Ga0209256_1000014
215 Ga0209256_1000200
216 Ga0207680_10368143
217 Ga0207647_10067739
218 Ga0207695_10022631
219 Ga0207695_10074092
220 Ga0207663_10063071
221 Ga0207700_10024453
222 Ga0207664_10161316
223 Ga0207670_10000241
224 Ga0207711_10001880
225 Ga0207667_10008314
226 Ga0207702_10042575
227 Ga0207698_10214955
228 Ga0209371_1029165
229 Ga0209371_1029168
230 Ga0268266_10359202
231 Ga0265318_10090362
232 Ga0265336_10010819
233 Ga0265338_10001905
234 Ga0265338_10009615
235 Ga0265338_10085199
236 Ga0265324_10011890
237 Ga0268256_1033446
238 Ga0268256_1034807
239 Ga0265330_10016454
240 Ga0265332_10010051
241 Ga0265332_10019183
242 Ga0265328_10013758
243 Ga0265320_10002053
244 Ga0265325_10057722
245 Ga0265325_10091130
246 Ga0265325_10145411
247 Ga0265329_10024984
248 Ga0265340_10004524
249 Ga0265340_10082501
250 Ga0265339_10005230
251 Ga0265339_10023284
252 Ga0265339_10089019
253 Ga0265331_10001121
254 Ga0265327_10109549
255 Ga0265316_10003132
256 Ga0265316_10003728
257 Ga0265316_10095354
258 Ga0265316_10098322
259 Ga0265316_10305356
260 Ga0307513_10041595
261 Ga0265314_10003033
262 Ga0265342_10079703
263 Ga0307412_10007282
264 Ga0307414_10337658
265 Ga0373946_0179814
266 Ga0373935_0030041
267 Ga0373927_0005887
268 Ga0373947_0000142
269 Ga0373925_0000221
270 Ga0495606_0071441
271 Ga0495632_0168921
272 Ga0495643_0049484
273 Ga0495668_0024001
274 Ga0495668_0058207
275 Ga0495624_0123186
276 Ga0495670_0037048
277 Ga0495649_0000444
278 Ga0495649_0039974
279 Ga0495687_031443
280 Ga0495686_0001036
281 Ga0495686_0012324
282 Ga0496115_0000988
283 Ga0496116_0054215
284 Ga0496122_0069228
285 Ga0496123_0047785
286 Ga0496123_0097013
287 Ga0496125_0003591
288 Ga0496125_0038952
289 Ga0496125_0062764
290 Ga0496125_0077419
291 Ga0496126_0173808
292 Ga0496126_0220577
293 Ga0495682_0122234
294 Ga0501034_0381162
295 Ga0501037_0146937
296 nmdc:mga00v17_159698_c1
297 Ga0500578_0046651
298 Ga0500643_005734
299 Ga0500655_025335
300 Ga0500573_0049348
301 Ga0500616_0000011
302 Ga0500616_0027636
303 Ga0500616_0084037
304 2643781539
305 2643928982
306 2644734988
307 2735837330
308 2753766632
309 2819719541
310 2821449851
311 2842112488
312 2842486801
313 2857521932
314 2917704780
315 2933588623
316 2936377395
317 2939603263
318 8005377762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

228

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

246

0.9

PF08659

KR

KR domain

36

208

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cql-assembly4.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9446 6 185
3emk-assembly1.cif.gz_C 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9431 2 183
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9388 4 188
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9375 2 183
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9329 6 182
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 6 179 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9288 6 72 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 6 182 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9241 2 182 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9194 6 88 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3WWV3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9877 1 185 GO:0016491
AF-A0A645FRN2-F1-model_v4 Oxidoreductase 0.9833 52 245 GO:0016020
GO:0016491
AF-A0A8B3MMC2-F1-model_v4 deleted 0.9829 1 245
AF-A0A4Q3WWV3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9824 1 185 GO:0016491
AF-A0A059DS82-F1-model_v4 DltE 0.9822 1 249 GO:0016020
GO:0016491

Map