F233191

General Info

Members Datasets Scaffolds Average Seq Length
159 73 318 335

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0139230|Ga0501070_0139230_249_1310
Length 353
Sequence VFSPLRFRRVFVAIPPMPRKHDDEPEAPKKISSYTVKLDDAQMEKLRSILVARGWTPFEVGYTRFAFKADHLKVNVSAYTSGKVVVAGKGTEDFVRDVIEPEVTGAAKLGYDEVLHPDWFESHAGLDESGKGDFFGPVIAATVIADKPAIEAWIKAGVKDSKKIAELQIGRLDKIIRETKGAVVEVCYCHTMARYNELMARPNANLNRLLAWQHATALTGALAKKPVRWGLLDQFSEQPLTQRELARKGVADFELKMRTKAEEDPVVAAASVVARAEFVRQMHALSKRFGAKLQKGAGPLVKEQAAQIIQKFGARALGDFAKLHFRTAYEVVAAAGKLDELPLPEPKARVEWE

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
11 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
12 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
13 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
21 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
22 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
23 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
24 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
25 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
26 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
27 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
31 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
32 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
33 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
34 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
35 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
49 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
57 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
70 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
73 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 0
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0139230 3300049586 Bacteria 2004
2 rootH2_10030129 3300003320 Bacteria 1586
3 rootL2_10040216 3300003322 Bacteria 1440
4 rootL2_10213016 3300003322 Bacteria 2070
5 rootH1_10311251 3300003323 Bacteria 2879
6 Ga0070658_10049189 3300005327 Bacteria 3415
7 Ga0068869_100000032 3300005334 Bacteria 58379
8 Ga0070713_100011079 3300005436 Bacteria 6548
9 Ga0068856_100017437 3300005614 Bacteria 6957
10 Ga0097621_100050598 3300006237 Bacteria 3379
11 Ga0068871_100013226 3300006358 Bacteria 6121
12 Ga0068865_100002429 3300006881 Bacteria 11011
13 Ga0163163_10099884 3300014325 Bacteria 2923
14 Ga0207705_10073222 3300025909 Bacteria 2485
15 Ga0207700_10003744 3300025928 Bacteria 8880
16 Ga0207704_10044273 3300025938 Bacteria 2636
17 Ga0207689_10000932 3300025942 Bacteria 28064
18 Ga0207661_10027368 3300025944 Bacteria 4355
19 Ga0207661_10030531 3300025944 Bacteria 4153
20 Ga0207639_10204537 3300026041 Bacteria 1696
21 Ga0207648_10001776 3300026089 Bacteria 23622
22 Ga0265337_1000519 3300028556 Bacteria 20390
23 Ga0265337_1031734 3300028556 Bacteria 1566
24 Ga0265326_10015740 3300028558 Bacteria 2191
25 Ga0265326_10030931 3300028558 Bacteria 1525
26 Ga0265319_1000050 3300028563 Bacteria 97690
27 Ga0265319_1000881 3300028563 Bacteria 19040
28 Ga0265319_1017148 3300028563 Bacteria 2759
29 Ga0265319_1046902 3300028563 Bacteria 1439
30 Ga0265319_1049299 3300028563 Bacteria 1395
31 Ga0265334_10001557 3300028573 Bacteria 11043
32 Ga0265334_10004713 3300028573 Bacteria 6005
33 Ga0265334_10050844 3300028573 Bacteria 1591
34 Ga0265318_10000047 3300028577 Bacteria 123944
35 Ga0265318_10000522 3300028577 Bacteria 27615
36 Ga0265318_10001186 3300028577 Bacteria 16021
37 Ga0265318_10002019 3300028577 Bacteria 11231
38 Ga0265318_10006645 3300028577 Bacteria 5306
39 Ga0265318_10013368 3300028577 Bacteria 3471
40 Ga0265323_10000076 3300028653 Bacteria 55887
41 Ga0265323_10001322 3300028653 Bacteria 12308
42 Ga0265323_10002818 3300028653 Bacteria 7828
43 Ga0265323_10006389 3300028653 Bacteria 4957
44 Ga0265323_10014487 3300028653 Bacteria 3122
45 Ga0265323_10026367 3300028653 Bacteria 2191
46 Ga0265322_10000399 3300028654 Bacteria 17926
47 Ga0265322_10001481 3300028654 Bacteria 7631
48 Ga0265336_10000521 3300028666 Bacteria 22232
49 Ga0265336_10020322 3300028666 Bacteria 2132
50 Ga0265338_10000339 3300028800 Bacteria 85119
51 Ga0265338_10009289 3300028800 Bacteria 11756
52 Ga0265324_10004515 3300029957 Bacteria 6250
53 Ga0265324_10015359 3300029957 Bacteria 2817
54 Ga0265324_10052890 3300029957 Bacteria 1395
55 Ga0265330_10007900 3300031235 Bacteria 5155
56 Ga0265330_10031326 3300031235 Bacteria 2384
57 Ga0265332_10046982 3300031238 Bacteria 1859
58 Ga0265320_10001455 3300031240 Bacteria 17276
59 Ga0265320_10002113 3300031240 Bacteria 13966
60 Ga0265320_10002186 3300031240 Bacteria 13753
61 Ga0265320_10004051 3300031240 Bacteria 9636
62 Ga0265320_10004225 3300031240 Bacteria 9436
63 Ga0265320_10006661 3300031240 Bacteria 7257
64 Ga0265320_10007659 3300031240 Bacteria 6680
65 Ga0265320_10007843 3300031240 Bacteria 6592
66 Ga0265320_10008226 3300031240 Bacteria 6402
67 Ga0265320_10016028 3300031240 Bacteria 4213
68 Ga0265320_10055363 3300031240 Bacteria 1909
69 Ga0265325_10009672 3300031241 Bacteria 5621
70 Ga0265339_10072187 3300031249 Bacteria 1837
71 Ga0265331_10015765 3300031250 Bacteria 3982
72 Ga0265331_10029617 3300031250 Bacteria 2730
73 Ga0265331_10067048 3300031250 Bacteria 1684
74 Ga0265327_10000325 3300031251 Bacteria 90949
75 Ga0265327_10001875 3300031251 Bacteria 24315
76 Ga0265327_10002019 3300031251 Bacteria 22908
77 Ga0265327_10009244 3300031251 Bacteria 7146
78 Ga0265327_10114079 3300031251 Bacteria 1287
79 Ga0265316_10004508 3300031344 Bacteria 13844
80 Ga0265316_10007866 3300031344 Bacteria 9976
81 Ga0265316_10010449 3300031344 Bacteria 8457
82 Ga0265316_10013083 3300031344 Bacteria 7400
83 Ga0265316_10027355 3300031344 Bacteria 4723
84 Ga0265316_10072941 3300031344 Unclassified 2644
85 Ga0265316_10088737 3300031344 Bacteria 2361
86 Ga0265316_10137625 3300031344 Bacteria 1837
87 Ga0307408_100000003 3300031548 Bacteria 618438
88 Ga0265313_10000165 3300031595 Bacteria 69129
89 Ga0265313_10001031 3300031595 Bacteria 27090
90 Ga0265313_10001557 3300031595 Bacteria 21281
91 Ga0265313_10002748 3300031595 Bacteria 14842
92 Ga0265313_10008030 3300031595 Bacteria 7075
93 Ga0265313_10017703 3300031595 Bacteria 4032
94 Ga0265313_10056341 3300031595 Bacteria 1859
95 Ga0307508_10000006 3300031616 Bacteria 275479
96 Ga0265314_10001982 3300031711 Bacteria 21748
97 Ga0265314_10005480 3300031711 Bacteria 11442
98 Ga0265314_10014596 3300031711 Bacteria 6271
99 Ga0265314_10015508 3300031711 Bacteria 6046
100 Ga0265314_10022053 3300031711 Bacteria 4883
101 Ga0265342_10003248 3300031712 Bacteria 13476
102 Ga0265342_10055270 3300031712 Bacteria 2357
103 Ga0265342_10073076 3300031712 Bacteria 1995
104 Ga0265342_10180710 3300031712 Bacteria 1155
105 Ga0307410_10000002 3300031852 Bacteria 145309
106 Ga0307407_10105879 3300031903 Bacteria 1755
107 Ga0307412_10020611 3300031911 Bacteria 4015
108 Ga0307409_100000025 3300031995 Bacteria 51516
109 Ga0307416_100000012 3300032002 Bacteria 296814
110 Ga0373951_0033545 3300035091 Unclassified 1217
111 Ga0373960_0049012 3300035121 Bacteria 1248
112 Ga0395905_0000010 3300037471 Bacteria 460729
113 Ga0439445_0030864 3300042004 Bacteria 1390
114 Ga0451577_0000087 3300042876 Bacteria 207662
115 Ga0451577_0003447 3300042876 Bacteria 17610
116 Ga0451577_0028977 3300042876 Bacteria 5007
117 Ga0453683_0000948 3300044673 Bacteria 27649
118 Ga0453683_0031400 3300044673 Bacteria 3357
119 Ga0453684_0000001 3300044712 Bacteria 2623166
120 Ga0453684_0027192 3300044712 Bacteria 8215
121 Ga0453684_0122107 3300044712 Bacteria 3143
122 Ga0453684_0439276 3300044712 Bacteria 1454
123 Ga0451576_0000071 3300045051 Bacteria 258795
124 Ga0451576_0001527 3300045051 Bacteria 38964
125 Ga0451576_0002156 3300045051 Bacteria 30456
126 Ga0451576_0003954 3300045051 Bacteria 19756
127 Ga0451576_0031566 3300045051 Bacteria 5646
128 Ga0451576_0542482 3300045051 Bacteria 1222
129 Ga0495598_0070128 3300046537 Bacteria 1102
130 Ga0501031_0037693 3300049568 Bacteria 3155
131 Ga0501032_0000292 3300049569 Bacteria 42003
132 Ga0501032_0027549 3300049569 Bacteria 3904
133 Ga0501032_0041752 3300049569 Bacteria 3114
134 Ga0501033_0000870 3300049570 Bacteria 27610
135 Ga0501033_0016866 3300049570 Bacteria 5521
136 Ga0501034_0041759 3300049571 Bacteria 4641
137 Ga0501034_0101260 3300049571 Bacteria 2874
138 Ga0501037_0038145 3300049573 Bacteria 3541
139 Ga0501037_0046399 3300049573 Bacteria 3186
140 Ga0501038_0020048 3300049574 Bacteria 6018
141 Ga0501039_0043359 3300049575 Bacteria 3475
142 Ga0501043_0128055 3300049579 Unclassified 1990
143 Ga0501046_0001449 3300049580 Bacteria 22829
144 Ga0501046_0161082 3300049580 Unclassified 1687
145 Ga0501047_0066542 3300049581 Bacteria 3473
146 Ga0501047_0299186 3300049581 Bacteria 1452
147 Ga0501048_0048762 3300049582 Bacteria 3020
148 Ga0501070_0132017 3300049586 Bacteria 2063
149 Ga0501080_0138157 3300049742 Bacteria 2254
150 Ga0501083_0008096 3300049744 Bacteria 7433
151 Ga0501083_0017143 3300049744 Bacteria 5052
152 Ga0501083_0091243 3300049744 Bacteria 2011
153 Ga0501035_0000168 3300049822 Bacteria 80065
154 Ga0501035_0004303 3300049822 Bacteria 13524
155 Ga0501035_0201013 3300049822 Bacteria 1709
156 Ga0501044_0000025 3300049823 Bacteria 187867
157 Ga0501044_0067546 3300049823 Bacteria 3642
158 Ga0501045_0072026 3300049824 Bacteria 2544
159 Ga0500622_0016424 3300053156 Bacteria 3956
160 Ga0501070_0139230
161 rootH2_10030129
162 rootL2_10040216
163 rootL2_10213016
164 rootH1_10311251
165 Ga0070658_10049189
166 Ga0068869_100000032
167 Ga0070713_100011079
168 Ga0068856_100017437
169 Ga0097621_100050598
170 Ga0068871_100013226
171 Ga0068865_100002429
172 Ga0163163_10099884
173 Ga0207705_10073222
174 Ga0207700_10003744
175 Ga0207704_10044273
176 Ga0207689_10000932
177 Ga0207661_10027368
178 Ga0207661_10030531
179 Ga0207639_10204537
180 Ga0207648_10001776
181 Ga0265337_1000519
182 Ga0265337_1031734
183 Ga0265326_10015740
184 Ga0265326_10030931
185 Ga0265319_1000050
186 Ga0265319_1000881
187 Ga0265319_1017148
188 Ga0265319_1046902
189 Ga0265319_1049299
190 Ga0265334_10001557
191 Ga0265334_10004713
192 Ga0265334_10050844
193 Ga0265318_10000047
194 Ga0265318_10000522
195 Ga0265318_10001186
196 Ga0265318_10002019
197 Ga0265318_10006645
198 Ga0265318_10013368
199 Ga0265323_10000076
200 Ga0265323_10001322
201 Ga0265323_10002818
202 Ga0265323_10006389
203 Ga0265323_10014487
204 Ga0265323_10026367
205 Ga0265322_10000399
206 Ga0265322_10001481
207 Ga0265336_10000521
208 Ga0265336_10020322
209 Ga0265338_10000339
210 Ga0265338_10009289
211 Ga0265324_10004515
212 Ga0265324_10015359
213 Ga0265324_10052890
214 Ga0265330_10007900
215 Ga0265330_10031326
216 Ga0265332_10046982
217 Ga0265320_10001455
218 Ga0265320_10002113
219 Ga0265320_10002186
220 Ga0265320_10004051
221 Ga0265320_10004225
222 Ga0265320_10006661
223 Ga0265320_10007659
224 Ga0265320_10007843
225 Ga0265320_10008226
226 Ga0265320_10016028
227 Ga0265320_10055363
228 Ga0265325_10009672
229 Ga0265339_10072187
230 Ga0265331_10015765
231 Ga0265331_10029617
232 Ga0265331_10067048
233 Ga0265327_10000325
234 Ga0265327_10001875
235 Ga0265327_10002019
236 Ga0265327_10009244
237 Ga0265327_10114079
238 Ga0265316_10004508
239 Ga0265316_10007866
240 Ga0265316_10010449
241 Ga0265316_10013083
242 Ga0265316_10027355
243 Ga0265316_10072941
244 Ga0265316_10088737
245 Ga0265316_10137625
246 Ga0307408_100000003
247 Ga0265313_10000165
248 Ga0265313_10001031
249 Ga0265313_10001557
250 Ga0265313_10002748
251 Ga0265313_10008030
252 Ga0265313_10017703
253 Ga0265313_10056341
254 Ga0307508_10000006
255 Ga0265314_10001982
256 Ga0265314_10005480
257 Ga0265314_10014596
258 Ga0265314_10015508
259 Ga0265314_10022053
260 Ga0265342_10003248
261 Ga0265342_10055270
262 Ga0265342_10073076
263 Ga0265342_10180710
264 Ga0307410_10000002
265 Ga0307407_10105879
266 Ga0307412_10020611
267 Ga0307409_100000025
268 Ga0307416_100000012
269 Ga0373951_0033545
270 Ga0373960_0049012
271 Ga0395905_0000010
272 Ga0439445_0030864
273 Ga0451577_0000087
274 Ga0451577_0003447
275 Ga0451577_0028977
276 Ga0453683_0000948
277 Ga0453683_0031400
278 Ga0453684_0000001
279 Ga0453684_0027192
280 Ga0453684_0122107
281 Ga0453684_0439276
282 Ga0451576_0000071
283 Ga0451576_0001527
284 Ga0451576_0002156
285 Ga0451576_0003954
286 Ga0451576_0031566
287 Ga0451576_0542482
288 Ga0495598_0070128
289 Ga0501031_0037693
290 Ga0501032_0000292
291 Ga0501032_0027549
292 Ga0501032_0041752
293 Ga0501033_0000870
294 Ga0501033_0016866
295 Ga0501034_0041759
296 Ga0501034_0101260
297 Ga0501037_0038145
298 Ga0501037_0046399
299 Ga0501038_0020048
300 Ga0501039_0043359
301 Ga0501043_0128055
302 Ga0501046_0001449
303 Ga0501046_0161082
304 Ga0501047_0066542
305 Ga0501047_0299186
306 Ga0501048_0048762
307 Ga0501070_0132017
308 Ga0501080_0138157
309 Ga0501083_0008096
310 Ga0501083_0017143
311 Ga0501083_0091243
312 Ga0501035_0000168
313 Ga0501035_0004303
314 Ga0501035_0201013
315 Ga0501044_0000025
316 Ga0501044_0067546
317 Ga0501045_0072026
318 Ga0500622_0016424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

124

328

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p83-assembly1.cif.gz_E structure of the pcna:rnase hii complex from archaeoglobus fulgidus. 0.8497 106 296
2dff-assembly1.cif.gz_A crystal structure of tk-rnase hii(1-204)-c 0.849 106 317
1io2-assembly1.cif.gz_A crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1 0.8479 106 319
3p83-assembly1.cif.gz_F structure of the pcna:rnase hii complex from archaeoglobus fulgidus. 0.8478 107 314
1uax-assembly2.cif.gz_B crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3 0.8331 106 320
ID Description Score Start End Superfamily
3vn5A01 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.9188 18 84 3.30.310.10
3asmA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9087 106 318 3.30.420.10
4py5A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9034 106 308 3.30.420.10
af_Q2FZD7_96_311_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9034 106 317 3.30.420.10
4py5A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8861 106 308 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2L2X9D7-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9681 106 314 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A521L4I6-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9658 105 316 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A355RYF0-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9637 105 313 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A536RNY1-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9627 105 317 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A2M7WLR2-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9611 105 318 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872

Map