F233226

General Info

Members Datasets Scaffolds Average Seq Length
159 125 159 145

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_1209901|Ga0501044_1209901_118_609
Length 163
Sequence MLRSRVSWLIAAMVRRSPMPTLDELLATSGLADKAQRIDDHLVRLQWGSAFVIAGISGSAVVAIAPLFRAVPAGKELAFFKKLLEHNAYMGGMASFALQPDGWVVLHAGRALKGIDGQEFATMVAGVGRFADQFDDQLLAEFYGGTVTDHASTAHSGEFPSTD

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
66 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
95 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
96 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
97 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
108 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
109 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
110 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
113 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
114 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
115 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
116 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
119 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
120 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
123 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
124 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.72
Nodule 0
Rhizoplane 0
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11317388 3300004798 Unclassified 505
2 Ga0070683_101012401 3300005329 Bacteria 798
3 Ga0070690_100262034 3300005330 Bacteria 1226
4 Ga0068869_100074092 3300005334 Bacteria 2526
5 Ga0070689_100034108 3300005340 Bacteria 3882
6 Ga0070689_100213640 3300005340 Bacteria 1580
7 Ga0070673_102066171 3300005364 Unclassified 541
8 Ga0070688_100626693 3300005365 Bacteria 826
9 Ga0070688_100780514 3300005365 Unclassified 746
10 Ga0070703_10038278 3300005406 Bacteria 1482
11 Ga0070713_101417262 3300005436 Unclassified 674
12 Ga0070701_10010209 3300005438 Bacteria 4143
13 Ga0070700_100496495 3300005441 Unclassified 938
14 Ga0070700_101549159 3300005441 Bacteria 565
15 Ga0070708_101420664 3300005445 Bacteria 647
16 Ga0070678_100003160 3300005456 Bacteria 9121
17 Ga0070678_100437831 3300005456 Bacteria 1143
18 Ga0070681_11193372 3300005458 Bacteria 683
19 Ga0070706_100211349 3300005467 Bacteria 1812
20 Ga0070707_101526610 3300005468 Bacteria 635
21 Ga0070698_100044074 3300005471 Bacteria 4570
22 Ga0070697_101199179 3300005536 Bacteria 676
23 Ga0070704_101443384 3300005549 Unclassified 632
24 Ga0070702_100128715 3300005615 Unclassified 1596
25 Ga0070702_100529040 3300005615 Bacteria 871
26 Ga0068859_101035382 3300005617 Unclassified 902
27 Ga0068864_102239039 3300005618 Bacteria 553
28 Ga0068861_100110758 3300005719 Bacteria 2199
29 Ga0068870_10886638 3300005840 Unclassified 629
30 Ga0068863_100791403 3300005841 Bacteria 946
31 Ga0068860_100631925 3300005843 Bacteria 1078
32 Ga0081455_10920368 3300005937 Unclassified 543
33 Ga0070717_10155841 3300006028 Bacteria 1979
34 Ga0097621_100250222 3300006237 Bacteria 1552
35 Ga0068871_100117539 3300006358 Bacteria 2243
36 Ga0075431_100033441 3300006847 Bacteria 5300
37 Ga0075429_100011631 3300006880 Bacteria 7633
38 Ga0075429_100159775 3300006880 Bacteria 1973
39 Ga0075429_100297278 3300006880 Unclassified 1413
40 Ga0075429_100646075 3300006880 Bacteria 927
41 Ga0097620_101035183 3300006931 Unclassified 902
42 Ga0075435_100101658 3300007076 Bacteria 2382
43 Ga0105244_10124564 3300009036 Bacteria 1246
44 Ga0114129_10640896 3300009147 Bacteria 1372
45 Ga0114129_11256245 3300009147 Bacteria 920
46 Ga0105243_10203524 3300009148 Bacteria 1738
47 Ga0105242_10982992 3300009176 Bacteria 850
48 Ga0157374_10114393 3300013296 Bacteria 2598
49 Ga0157378_10021563 3300013297 Bacteria 5666
50 Ga0213876_10247586 3300021384 Bacteria 947
51 Ga0207653_10054187 3300025885 Bacteria 1341
52 Ga0207692_10272829 3300025898 Bacteria 1021
53 Ga0207643_10457886 3300025908 Bacteria 812
54 Ga0207684_10217818 3300025910 Bacteria 1647
55 Ga0207662_10151249 3300025918 Bacteria 1476
56 Ga0207652_11667408 3300025921 Unclassified 542
57 Ga0207686_10426900 3300025934 Bacteria 1015
58 Ga0207709_10119273 3300025935 Bacteria 1778
59 Ga0207670_10058338 3300025936 Unclassified 2622
60 Ga0207670_10197723 3300025936 Bacteria 1525
61 Ga0207677_10308191 3300026023 Bacteria 1311
62 Ga0207708_10400094 3300026075 Unclassified 1135
63 Ga0207641_11474389 3300026088 Bacteria 682
64 Ga0207675_100676884 3300026118 Unclassified 1039
65 Ga0207683_10008088 3300026121 Bacteria 8996
66 Ga0207683_10565414 3300026121 Bacteria 1052
67 Ga0268264_10608257 3300028381 Bacteria 1078
68 Ga0307517_10106597 3300028786 Bacteria 2166
69 Ga0265338_10034254 3300028800 Bacteria 4912
70 Ga0307513_10060633 3300031456 Bacteria 4010
71 Ga0307509_10000010 3300031507 Bacteria 307427
72 Ga0307509_10395126 3300031507 Bacteria 1091
73 Ga0307508_10016816 3300031616 Bacteria 6656
74 Ga0307508_10414198 3300031616 Unclassified 939
75 Ga0307514_10214735 3300031649 Unclassified 1189
76 Ga0307516_10227016 3300031730 Unclassified 1573
77 Ga0307415_100072932 3300032126 Bacteria 2420
78 Ga0307507_10163720 3300033179 Bacteria 1636
79 Ga0373940_0177038 3300035088 Unclassified 692
80 Ga0373944_0119804 3300035089 Bacteria 906
81 Ga0373949_0000086 3300035090 Bacteria 34739
82 Ga0373936_0000002 3300035113 Bacteria 452874
83 Ga0373954_0097734 3300035118 Bacteria 1415
84 Ga0373956_0103852 3300035119 Bacteria 1320
85 Ga0373961_0000123 3300035241 Bacteria 39524
86 Ga0395900_0218236 3300037418 Unclassified 1924
87 Ga0395905_0199116 3300037471 Unclassified 1878
88 Ga0395901_1226265 3300038443 Unclassified 715
89 Ga0436365_0369855 3300039437 Unclassified 790
90 Ga0436365_1575825 3300039437 Bacteria 10088
91 Ga0436363_0444066 3300039450 Bacteria 888
92 Ga0451577_0586328 3300042876 Bacteria 1012
93 Ga0495603_0132057 3300046455 Bacteria 1454
94 Ga0495638_0107058 3300046460 Bacteria 1665
95 Ga0495622_0084997 3300046557 Bacteria 1455
96 Ga0495625_0502763 3300046660 Bacteria 741
97 Ga0495649_0142454 3300046694 Bacteria 1261
98 Ga0495686_0026926 3300047472 Bacteria 3758
99 Ga0495686_0065143 3300047472 Bacteria 2254
100 Ga0501292_001490 3300049515 Bacteria 2890
101 Ga0501033_1178753 3300049570 Bacteria 508
102 Ga0501036_0774875 3300049572 Bacteria 791
103 Ga0501037_0560644 3300049573 Unclassified 770
104 Ga0501047_0001542 3300049581 Bacteria 22542
105 Ga0501047_0089596 3300049581 Bacteria 2953
106 Ga0501069_0028231 3300049585 Bacteria 3076
107 Ga0501070_0015663 3300049586 Bacteria 6374
108 Ga0501070_0092927 3300049586 Bacteria 2496
109 Ga0501070_0236325 3300049586 Bacteria 1496
110 Ga0501070_1126323 3300049586 Unclassified 604
111 Ga0501071_0160227 3300049587 Bacteria 1681
112 Ga0501074_0083004 3300049590 Unclassified 2298
113 Ga0501074_0925591 3300049590 Unclassified 613
114 Ga0501227_000463 3300049665 Bacteria 8647
115 Ga0501227_007932 3300049665 Bacteria 2279
116 Ga0501225_0005999 3300049705 Bacteria 3553
117 Ga0501229_002541 3300049706 Bacteria 2150
118 Ga0501234_023411 3300049707 Bacteria 988
119 Ga0501083_0065934 3300049744 Bacteria 2411
120 Ga0501044_0010197 3300049823 Bacteria 10207
121 Ga0501044_0272398 3300049823 Bacteria 1628
122 Ga0501044_1209901 3300049823 Unclassified 623
123 Ga0501220_00984 3300049852 Bacteria 986
124 nmdc:mga05p37_1021915_c1 3300050507 Bacteria 875
125 nmdc:mga05p37_1124225_c1 3300050507 Bacteria 820
126 nmdc:mga09592_22300_c1 3300050508 Bacteria 5225
127 nmdc:mga09592_22630_c1 3300050508 Bacteria 5188
128 nmdc:mga09592_318699_c1 3300050508 Bacteria 1347
129 nmdc:mga09592_531558_c1 3300050508 Bacteria 1011
130 nmdc:mga09592_57048_c1 3300050508 Bacteria 3300
131 nmdc:mga0qj67_203738_c1 3300050509 Bacteria 1607
132 nmdc:mga06r32_19895_c1 3300050510 Bacteria 6170
133 nmdc:mga0rr50_23795_c1 3300050513 Bacteria 4232
134 Ga0500635_0007950 3300053080 Bacteria 2889
135 Ga0500578_0134286 3300053086 Bacteria 1550
136 Ga0500646_0018818 3300053090 Bacteria 1822
137 Ga0500647_0368731 3300053091 Unclassified 592
138 Ga0500583_0171978 3300053092 Unclassified 1079
139 Ga0500566_0018485 3300053094 Bacteria 4092
140 Ga0500566_0049909 3300053094 Bacteria 2397
141 Ga0500566_0249029 3300053094 Unclassified 865
142 Ga0500640_007658 3300053095 Bacteria 4221
143 Ga0500554_002894 3300053102 Bacteria 3435
144 Ga0500572_001968 3300053111 Bacteria 5152
145 Ga0500595_003578 3300053119 Bacteria 7220
146 Ga0500597_030965 3300053120 Bacteria 2201
147 Ga0500597_257615 3300053120 Unclassified 711
148 Ga0500614_000142 3300053123 Bacteria 17834
149 Ga0500614_076623 3300053123 Bacteria 928
150 Ga0500642_0254701 3300053130 Unclassified 805
151 Ga0500559_0047679 3300053136 Bacteria 1882
152 Ga0500564_125410 3300053138 Unclassified 1115
153 Ga0500568_0009180 3300053139 Bacteria 4716
154 Ga0500568_0022118 3300053139 Bacteria 2727
155 Ga0500603_029251 3300053150 Bacteria 1411
156 Ga0500603_044385 3300053150 Bacteria 1197
157 Ga0500636_0211115 3300053177 Bacteria 1019
158 Ga0500637_0210334 3300053178 Unclassified 1104
159 Ga0501084_0922864 3300054114 Bacteria 734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10034254 Ga0265338_100342544 123
2 3300050509 nmdc:mga0qj67_203738_c1 nmdc:mga0qj67_203738_c1_829_1275 126
3 3300005458 Ga0070681_11193372 Ga0070681_111933722 127
4 3300005456 Ga0070678_100003160 Ga0070678_1000031606 128
5 3300005456 Ga0070678_100437831 Ga0070678_1004378311 128
6 3300006880 Ga0075429_100646075 Ga0075429_1006460752 128
7 3300009147 Ga0114129_10640896 Ga0114129_106408962 128
8 3300013296 Ga0157374_10114393 Ga0157374_101143933 128
9 3300021384 Ga0213876_10247586 Ga0213876_102475862 128
10 3300025934 Ga0207686_10426900 Ga0207686_104269002 128
11 3300026121 Ga0207683_10008088 Ga0207683_100080887 128
12 3300026121 Ga0207683_10565414 Ga0207683_105654142 128
13 3300037471 Ga0395905_0199116 Ga0395905_0199116_118_543 128
14 3300039437 Ga0436365_1575825 Ga0436365_1575825_9132_9551 128
15 3300039450 Ga0436363_0444066 Ga0436363_0444066_164_583 128
16 3300049570 Ga0501033_1178753 Ga0501033_1178753_15_434 128
17 3300049572 Ga0501036_0774875 Ga0501036_0774875_350_769 128
18 3300049581 Ga0501047_0001542 Ga0501047_0001542_12439_12858 128
19 3300049581 Ga0501047_0089596 Ga0501047_0089596_2454_2873 128
20 3300049586 Ga0501070_0015663 Ga0501070_0015663_1132_1551 128
21 3300049586 Ga0501070_1126323 Ga0501070_1126323_165_584 128
22 3300049590 Ga0501074_0083004 Ga0501074_0083004_715_1134 128
23 3300049590 Ga0501074_0925591 Ga0501074_0925591_86_505 128
24 3300049823 Ga0501044_0010197 Ga0501044_0010197_9098_9517 128
25 3300049823 Ga0501044_0272398 Ga0501044_0272398_168_587 128
26 3300050507 nmdc:mga05p37_1124225_c1 nmdc:mga05p37_1124225_c1_311_733 128
27 3300050508 nmdc:mga09592_531558_c1 nmdc:mga09592_531558_c1_152_574 128
28 3300005364 Ga0070673_102066171 Ga0070673_1020661711 129
29 3300005406 Ga0070703_10038278 Ga0070703_100382782 129
30 3300005445 Ga0070708_101420664 Ga0070708_1014206642 129
31 3300005467 Ga0070706_100211349 Ga0070706_1002113492 129
32 3300005471 Ga0070698_100044074 Ga0070698_1000440744 129
33 3300005549 Ga0070704_101443384 Ga0070704_1014433841 129
34 3300006358 Ga0068871_100117539 Ga0068871_1001175392 129
35 3300006847 Ga0075431_100033441 Ga0075431_1000334412 129
36 3300006880 Ga0075429_100011631 Ga0075429_1000116318 129
37 3300009147 Ga0114129_11256245 Ga0114129_112562452 129
38 3300009176 Ga0105242_10982992 Ga0105242_109829922 129
39 3300025885 Ga0207653_10054187 Ga0207653_100541871 129
40 3300025898 Ga0207692_10272829 Ga0207692_102728292 129
41 3300025910 Ga0207684_10217818 Ga0207684_102178182 129
42 3300037418 Ga0395900_0218236 Ga0395900_0218236_810_1232 129
43 3300038443 Ga0395901_1226265 Ga0395901_1226265_201_623 129
44 3300042876 Ga0451577_0586328 Ga0451577_0586328_158_583 129
45 3300049515 Ga0501292_001490 Ga0501292_001490_927_1352 129
46 3300049665 Ga0501227_000463 Ga0501227_000463_7963_8388 129
47 3300049665 Ga0501227_007932 Ga0501227_007932_312_737 129
48 3300049705 Ga0501225_0005999 Ga0501225_0005999_432_857 129
49 3300049706 Ga0501229_002541 Ga0501229_002541_1183_1608 129
50 3300049707 Ga0501234_023411 Ga0501234_023411_159_584 129
51 3300049852 Ga0501220_00984 Ga0501220_00984_411_836 129
52 3300050507 nmdc:mga05p37_1021915_c1 nmdc:mga05p37_1021915_c1_220_648 129
53 3300050508 nmdc:mga09592_22300_c1 nmdc:mga09592_22300_c1_1735_2163 129
54 3300050510 nmdc:mga06r32_19895_c1 nmdc:mga06r32_19895_c1_2137_2565 129
55 3300054114 Ga0501084_0922864 Ga0501084_0922864_43_468 129
56 3300035089 Ga0373944_0119804 Ga0373944_0119804_12_431 130
57 3300046557 Ga0495622_0084997 Ga0495622_0084997_1021_1440 130
58 3300053139 Ga0500568_0022118 Ga0500568_0022118_1879_2307 130
59 3300047472 Ga0495686_0026926 Ga0495686_0026926_2372_2857 132
60 3300050508 nmdc:mga09592_318699_c1 nmdc:mga09592_318699_c1_73_513 133
61 3300006237 Ga0097621_100250222 Ga0097621_1002502222 134
62 3300046460 Ga0495638_0107058 Ga0495638_0107058_371_811 135
63 3300049585 Ga0501069_0028231 Ga0501069_0028231_2062_2523 135
64 3300049586 Ga0501070_0092927 Ga0501070_0092927_1165_1626 135
65 3300049586 Ga0501070_0236325 Ga0501070_0236325_977_1432 135
66 3300049587 Ga0501071_0160227 Ga0501071_0160227_490_951 135
67 3300049744 Ga0501083_0065934 Ga0501083_0065934_1074_1535 135
68 3300053130 Ga0500642_0254701 Ga0500642_0254701_283_723 135
69 3300053139 Ga0500568_0009180 Ga0500568_0009180_3598_4038 135
70 3300031649 Ga0307514_10214735 Ga0307514_102147351 136
71 3300049573 Ga0501037_0560644 Ga0501037_0560644_37_474 136
72 3300049823 Ga0501044_1209901 Ga0501044_1209901_118_609 136
73 3300005329 Ga0070683_101012401 Ga0070683_1010124012 137
74 3300005330 Ga0070690_100262034 Ga0070690_1002620342 137
75 3300005334 Ga0068869_100074092 Ga0068869_1000740923 137
76 3300005340 Ga0070689_100034108 Ga0070689_1000341084 137
77 3300005340 Ga0070689_100213640 Ga0070689_1002136402 137
78 3300005365 Ga0070688_100626693 Ga0070688_1006266932 137
79 3300005365 Ga0070688_100780514 Ga0070688_1007805141 137
80 3300005436 Ga0070713_101417262 Ga0070713_1014172621 137
81 3300005438 Ga0070701_10010209 Ga0070701_100102092 137
82 3300005441 Ga0070700_100496495 Ga0070700_1004964952 137
83 3300005441 Ga0070700_101549159 Ga0070700_1015491591 137
84 3300005468 Ga0070707_101526610 Ga0070707_1015266102 137
85 3300005615 Ga0070702_100128715 Ga0070702_1001287152 137
86 3300005615 Ga0070702_100529040 Ga0070702_1005290402 137
87 3300005617 Ga0068859_101035382 Ga0068859_1010353822 137
88 3300005618 Ga0068864_102239039 Ga0068864_1022390391 137
89 3300005719 Ga0068861_100110758 Ga0068861_1001107583 137
90 3300005840 Ga0068870_10886638 Ga0068870_108866381 137
91 3300005841 Ga0068863_100791403 Ga0068863_1007914032 137
92 3300005843 Ga0068860_100631925 Ga0068860_1006319252 137
93 3300005937 Ga0081455_10920368 Ga0081455_109203681 137
94 3300006028 Ga0070717_10155841 Ga0070717_101558412 137
95 3300006931 Ga0097620_101035183 Ga0097620_1010351832 137
96 3300009036 Ga0105244_10124564 Ga0105244_101245642 137
97 3300009148 Ga0105243_10203524 Ga0105243_102035242 137
98 3300013297 Ga0157378_10021563 Ga0157378_100215631 137
99 3300025908 Ga0207643_10457886 Ga0207643_104578862 137
100 3300025918 Ga0207662_10151249 Ga0207662_101512492 137
101 3300025921 Ga0207652_11667408 Ga0207652_116674081 137
102 3300025935 Ga0207709_10119273 Ga0207709_101192733 137
103 3300025936 Ga0207670_10058338 Ga0207670_100583382 137
104 3300025936 Ga0207670_10197723 Ga0207670_101977231 137
105 3300026023 Ga0207677_10308191 Ga0207677_103081911 137
106 3300026075 Ga0207708_10400094 Ga0207708_104000941 137
107 3300026088 Ga0207641_11474389 Ga0207641_114743892 137
108 3300026118 Ga0207675_100676884 Ga0207675_1006768842 137
109 3300028381 Ga0268264_10608257 Ga0268264_106082572 137
110 3300028786 Ga0307517_10106597 Ga0307517_101065973 137
111 3300031456 Ga0307513_10060633 Ga0307513_100606335 137
112 3300031507 Ga0307509_10000010 Ga0307509_10000010210 137
113 3300031507 Ga0307509_10395126 Ga0307509_103951262 137
114 3300031616 Ga0307508_10016816 Ga0307508_100168164 137
115 3300031616 Ga0307508_10414198 Ga0307508_104141982 137
116 3300031730 Ga0307516_10227016 Ga0307516_102270162 137
117 3300033179 Ga0307507_10163720 Ga0307507_101637202 137
118 3300035088 Ga0373940_0177038 Ga0373940_0177038_117_560 137
119 3300035090 Ga0373949_0000086 Ga0373949_0000086_5467_5907 137
120 3300035113 Ga0373936_0000002 Ga0373936_0000002_115575_116015 137
121 3300035118 Ga0373954_0097734 Ga0373954_0097734_172_612 137
122 3300035119 Ga0373956_0103852 Ga0373956_0103852_179_622 137
123 3300035241 Ga0373961_0000123 Ga0373961_0000123_21334_21774 137
124 3300046455 Ga0495603_0132057 Ga0495603_0132057_690_1160 137
125 3300046660 Ga0495625_0502763 Ga0495625_0502763_152_595 137
126 3300046694 Ga0495649_0142454 Ga0495649_0142454_714_1184 137
127 3300053080 Ga0500635_0007950 Ga0500635_0007950_1382_1822 137
128 3300053086 Ga0500578_0134286 Ga0500578_0134286_1001_1441 137
129 3300053090 Ga0500646_0018818 Ga0500646_0018818_1329_1769 137
130 3300053091 Ga0500647_0368731 Ga0500647_0368731_133_573 137
131 3300053092 Ga0500583_0171978 Ga0500583_0171978_32_472 137
132 3300053094 Ga0500566_0018485 Ga0500566_0018485_3186_3626 137
133 3300053094 Ga0500566_0049909 Ga0500566_0049909_1479_1919 137
134 3300053094 Ga0500566_0249029 Ga0500566_0249029_400_840 137
135 3300053120 Ga0500597_030965 Ga0500597_030965_486_926 137
136 3300053120 Ga0500597_257615 Ga0500597_257615_34_474 137
137 3300053123 Ga0500614_076623 Ga0500614_076623_406_846 137
138 3300053138 Ga0500564_125410 Ga0500564_125410_598_1038 137
139 3300053150 Ga0500603_029251 Ga0500603_029251_475_915 137
140 3300053150 Ga0500603_044385 Ga0500603_044385_397_837 137
141 3300053177 Ga0500636_0211115 Ga0500636_0211115_312_752 137
142 3300032126 Ga0307415_100072932 Ga0307415_1000729321 138
143 3300047472 Ga0495686_0065143 Ga0495686_0065143_646_1161 138
144 3300006880 Ga0075429_100159775 Ga0075429_1001597752 139
145 3300006880 Ga0075429_100297278 Ga0075429_1002972783 139
146 3300050508 nmdc:mga09592_22630_c1 nmdc:mga09592_22630_c1_358_822 139
147 3300050508 nmdc:mga09592_57048_c1 nmdc:mga09592_57048_c1_1278_1742 139
148 3300005536 Ga0070697_101199179 Ga0070697_1011991792 140
149 3300007076 Ga0075435_100101658 Ga0075435_1001016582 140
150 3300050513 nmdc:mga0rr50_23795_c1 nmdc:mga0rr50_23795_c1_2843_3322 140
151 3300053095 Ga0500640_007658 Ga0500640_007658_921_1373 140
152 3300053102 Ga0500554_002894 Ga0500554_002894_1552_2004 140
153 3300053111 Ga0500572_001968 Ga0500572_001968_1392_1844 140
154 3300053119 Ga0500595_003578 Ga0500595_003578_1342_1794 140
155 3300053123 Ga0500614_000142 Ga0500614_000142_13873_14325 140
156 3300053136 Ga0500559_0047679 Ga0500559_0047679_869_1321 140
157 3300053178 Ga0500637_0210334 Ga0500637_0210334_393_845 140
158 3300039437 Ga0436365_0369855 Ga0436365_0369855_88_549 142
159 3300004798 Ga0058859_11317388 Ga0058859_113173881 143

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dzi-assembly1.cif.gz_B intermediate of fabp with a delay time of 300 ns 0.8447 17 47
3stn-assembly1.cif.gz_A structure of human lfabp (apo-lfabp) 0.8411 17 47
6mp4-assembly2.cif.gz_E human liver fabp1 bound to tetrahydrocannabinol 0.8215 17 47
6drg-assembly1.cif.gz_A nmr solution structure of wild type hfabp1 with gw7647 0.7893 17 47
2bsi-assembly1.cif.gz_B crystal structure of the type iii secretion chaperone syct from yersinia enterocolitica (crystal form 1) 0.7557 3 116
ID Description Score Start End Superfamily
af_A3KFD5_112_191_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8535 23 47 2.40.50.100
af_O62012_118_176_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7896 19 47 2.40.50.100
af_O86336_13_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7785 17 43 3.60.15.10
af_P91522_64_133_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7705 22 47 2.40.50.100
af_I1L2X5_101_167_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.742 18 47 3.10.450.700
ID Description Score Start End GO Terms
AF-A0A7W0YXN8-F1-model_v4 YbjN domain-containing protein 0.7772 3 115
AF-A0A7X9IWR3-F1-model_v4 YbjN domain-containing protein 0.7735 1 118
AF-A0A7C5MQA6-F1-model_v4 DUF695 domain-containing protein 0.7651 1 113
AF-A0A7Y6AB98-F1-model_v4 YbjN domain-containing protein 0.764 2 118
AF-A0A1J5SSF4-F1-model_v4 Sensory transduction regulator 0.7607 2 119

Feature Viewer

pLDDT pTM Quality
78.99 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map