F234498

General Info

Members Datasets Scaffolds Average Seq Length
160 119 157 128

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10300827|Ga0114129_103008272
Length 150
Sequence LRNSVRPAKPWDDRTGQYAQILWKECDMFENTNAFSGFSVDDLDRARSFYGDTLGLRVTDENGMLRLELAGGNRVLIYPKPNHTPASFTILNFTVDDIDKAVDELAARGVSLERYEGFDQDERGIMRDGQGPRIAWFTDPAGNVLSVIQN

Samples

Sample ID Description Type Environment
1 2149837012 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ Metagenome Rhizosphere
2 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
3 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
4 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
108 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
111 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
112 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
113 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
114 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
115 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
116 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0.62
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20
Nodule 0
Rhizoplane 5
Rhizosphere 72.5
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 _GD4IA4401BBAK3 2149837012 Bacteria 521
2 Ga0070680_100903017 3300005336 Bacteria 762
3 Ga0070691_10061243 3300005341 Bacteria 1810
4 Ga0070688_100001412 3300005365 Bacteria 11970
5 Ga0070714_101187920 3300005435 Bacteria 744
6 Ga0070708_100208334 3300005445 Bacteria 1832
7 Ga0070685_10001592 3300005466 Bacteria 11970
8 Ga0070706_100290743 3300005467 Bacteria 1525
9 Ga0070699_100347019 3300005518 Bacteria 1337
10 Ga0070679_101250101 3300005530 Bacteria 688
11 Ga0068856_100000210 3300005614 Bacteria 63036
12 Ga0068856_100110436 3300005614 Bacteria 2747
13 Ga0068852_100000983 3300005616 Bacteria 18760
14 Ga0068852_100535462 3300005616 Bacteria 1170
15 Ga0068863_100055760 3300005841 Bacteria 3742
16 Ga0081455_10077060 3300005937 Bacteria 2744
17 Ga0081539_10088546 3300005985 Bacteria 1605
18 Ga0075365_10182555 3300006038 Bacteria 1467
19 Ga0075365_10707880 3300006038 Unclassified 711
20 Ga0075368_10001135 3300006042 Bacteria 8401
21 Ga0075363_100008278 3300006048 Bacteria 4834
22 Ga0075364_10001012 3300006051 Bacteria 14896
23 Ga0075364_10900055 3300006051 Unclassified 602
24 Ga0075362_10029759 3300006177 Bacteria 2355
25 Ga0075367_10026223 3300006178 Bacteria 3303
26 Ga0075369_10000181 3300006186 Bacteria 18065
27 Ga0075428_100764133 3300006844 Bacteria 1028
28 Ga0075428_100802353 3300006844 Bacteria 1000
29 Ga0075430_100121626 3300006846 Bacteria 2176
30 Ga0075430_100346419 3300006846 Bacteria 1227
31 Ga0075431_102200228 3300006847 Bacteria 506
32 Ga0075434_100248160 3300006871 Bacteria 1799
33 Ga0075429_100007850 3300006880 Bacteria 9269
34 Ga0075429_101242859 3300006880 Bacteria 650
35 Ga0075435_100198709 3300007076 Bacteria 1699
36 Ga0105245_10000012 3300009098 Bacteria 267151
37 Ga0105245_10601200 3300009098 Bacteria 1126
38 Ga0105245_10822627 3300009098 Bacteria 968
39 Ga0114129_10048820 3300009147 Bacteria 5949
40 Ga0114129_10300827 3300009147 Bacteria 2138
41 Ga0114129_10456607 3300009147 Bacteria 1675
42 Ga0114129_10463792 3300009147 Bacteria 1660
43 Ga0114129_13036923 3300009147 Bacteria 551
44 Ga0105242_10000104 3300009176 Bacteria 60125
45 Ga0105248_10000126 3300009177 Bacteria 88461
46 Ga0157370_11238786 3300013104 Bacteria 673
47 Ga0157369_10000135 3300013105 Bacteria 105364
48 Ga0157369_10031039 3300013105 Bacteria 5889
49 Ga0157374_10132308 3300013296 Bacteria 2415
50 Ga0157374_10908906 3300013296 Bacteria 898
51 Ga0157372_10472522 3300013307 Bacteria 1462
52 Ga0157372_12519553 3300013307 Bacteria 590
53 Ga0157375_10045193 3300013308 Bacteria 4286
54 Ga0157375_12233941 3300013308 Unclassified 652
55 Ga0206353_11267052 3300020082 Bacteria 519
56 Ga0207684_10092420 3300025910 Bacteria 2579
57 Ga0207687_10386641 3300025927 Bacteria 1148
58 Ga0207687_11465631 3300025927 Bacteria 586
59 Ga0207664_10468368 3300025929 Bacteria 1126
60 Ga0207686_10000063 3300025934 Bacteria 96427
61 Ga0207704_10000009 3300025938 Bacteria 198266
62 Ga0207711_10000024 3300025941 Bacteria 293596
63 Ga0207702_10000099 3300026078 Bacteria 100461
64 Ga0207702_10712303 3300026078 Bacteria 989
65 Ga0207641_10011355 3300026088 Bacteria 7310
66 Ga0207683_11080223 3300026121 Bacteria 744
67 Ga0207698_10000009 3300026142 Bacteria 281300
68 Ga0209813_10039798 3300027866 Bacteria 1426
69 Ga0268266_10294718 3300028379 Unclassified 1512
70 Ga0265334_10193715 3300028573 Unclassified 708
71 Ga0265338_10364889 3300028800 Bacteria 1035
72 Ga0307405_10281567 3300031731 Bacteria 1252
73 Ga0307410_10409092 3300031852 Bacteria 1098
74 Ga0307410_10417938 3300031852 Bacteria 1087
75 Ga0307406_10213013 3300031901 Bacteria 1431
76 Ga0307406_10306589 3300031901 Bacteria 1222
77 Ga0307412_10801129 3300031911 Bacteria 818
78 Ga0307409_100027813 3300031995 Bacteria 4016
79 Ga0307409_100382688 3300031995 Bacteria 1338
80 Ga0307409_101004209 3300031995 Bacteria 853
81 Ga0307409_101804271 3300031995 Bacteria 641
82 Ga0307416_100294664 3300032002 Bacteria 1608
83 Ga0307416_103685975 3300032002 Unclassified 513
84 Ga0307411_10342837 3300032005 Bacteria 1215
85 Ga0307411_10856733 3300032005 Bacteria 804
86 Ga0307415_100085182 3300032126 Bacteria 2270
87 Ga0307415_100183462 3300032126 Bacteria 1644
88 Ga0307415_100241939 3300032126 Bacteria 1460
89 Ga0307415_101226564 3300032126 Bacteria 708
90 Ga0307415_101986579 3300032126 Bacteria 566
91 Ga0395900_0019276 3300037418 Bacteria 6956
92 Ga0395900_1739481 3300037418 Bacteria 534
93 Ga0395898_0078887 3300037466 Bacteria 3177
94 Ga0395901_0264223 3300038443 Bacteria 1791
95 Ga0451791_1897080 3300041451 Bacteria 548
96 Ga0466965_0394283 3300044683 Bacteria 764
97 Ga0466963_0036775 3300044694 Bacteria 3194
98 Ga0466970_0312209 3300044765 Bacteria 888
99 Ga0466957_1422280 3300044842 Bacteria 505
100 Ga0466960_0350970 3300044901 Bacteria 841
101 Ga0466958_0257357 3300045836 Bacteria 1117
102 Ga0466967_0208077 3300045976 Bacteria 1855
103 Ga0466967_0877325 3300045976 Bacteria 892
104 Ga0495629_0009096 3300046459 Bacteria 7276
105 Ga0495629_0013866 3300046459 Bacteria 5815
106 Ga0495630_0643754 3300046517 Bacteria 812
107 Ga0495588_0200515 3300046674 Unclassified 1054
108 Ga0495686_0021406 3300047472 Bacteria 4294
109 Ga0496102_0000045 3300048905 Bacteria 186726
110 Ga0496103_0000050 3300048906 Bacteria 152034
111 Ga0496109_0742530 3300048912 Unclassified 919
112 Ga0496112_0162771 3300048915 Bacteria 2197
113 Ga0496112_0614851 3300048915 Bacteria 1018
114 Ga0496114_0487316 3300048917 Bacteria 1091
115 Ga0496115_0000071 3300048918 Bacteria 91922
116 Ga0496117_0235790 3300048920 Bacteria 1008
117 Ga0496126_0062259 3300048929 Bacteria 3349
118 Ga0501067_0109473 3300049583 Bacteria 1536
119 Ga0501068_0552340 3300049584 Bacteria 749
120 Ga0501069_0139427 3300049585 Bacteria 1391
121 Ga0501071_0346039 3300049587 Bacteria 1131
122 Ga0501081_0317146 3300049743 Bacteria 1145
123 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
124 nmdc:mga0yw44_457763_c1 3300050492 Unclassified 865
125 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
126 nmdc:mga06z11_8591_c1 3300050494 Bacteria 4269
127 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
128 nmdc:mga07m45_432254_c1 3300050496 Unclassified 764
129 nmdc:mga05p37_1189579_c1 3300050507 Bacteria 789
130 nmdc:mga05p37_462806_c1 3300050507 Bacteria 1465
131 nmdc:mga05p37_90316_c1 3300050507 Bacteria 3775
132 nmdc:mga09592_134445_c1 3300050508 Bacteria 2130
133 nmdc:mga09592_714123_c1 3300050508 Bacteria 852
134 nmdc:mga0qj67_19367_c1 3300050509 Bacteria 5199
135 nmdc:mga06r32_546422_c1 3300050510 Bacteria 1133
136 nmdc:mga0n895_255624_c1 3300050512 Bacteria 1778
137 nmdc:mga0rr50_155067_c1 3300050513 Bacteria 1854
138 nmdc:mga0rr50_373125_c1 3300050513 Bacteria 1202
139 nmdc:mga0a205_38108_c1 3300050515 Bacteria 4624
140 nmdc:mga0sz30_82777_c1 3300050516 Bacteria 1390
141 Ga0495655_0000004 3300053083 Bacteria 293683
142 Ga0500643_000072 3300053087 Bacteria 112810
143 Ga0500646_0000005 3300053090 Bacteria 130895
144 Ga0500583_0040995 3300053092 Unclassified 2100
145 Ga0500583_0066950 3300053092 Bacteria 1710
146 Ga0500566_0008381 3300053094 Bacteria 6112
147 Ga0500641_0000001 3300053096 Bacteria 1115973
148 Ga0500650_0007092 3300053098 Bacteria 4335
149 Ga0500650_0011791 3300053098 Unclassified 3614
150 Ga0500556_0000001 3300053104 Bacteria 1135060
151 Ga0500621_188902 3300053126 Bacteria 740
152 Ga0500628_000004 3300053129 Bacteria 202098
153 Ga0500652_000001 3300053131 Bacteria 946868
154 Ga0500568_0000006 3300053139 Bacteria 522235
155 Ga0500573_0040846 3300053140 Bacteria 2679
156 Ga0500620_004171 3300053155 Unclassified 3192
157 Ga0530510_0383708 3300061734 Bacteria 1058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_432254_c1 nmdc:mga07m45_432254_c1_45_389 108
2 3300053098 Ga0500650_0007092 Ga0500650_0007092_2505_2882 110
3 3300050516 nmdc:mga0sz30_82777_c1 nmdc:mga0sz30_82777_c1_363_719 112
4 3300050513 nmdc:mga0rr50_155067_c1 nmdc:mga0rr50_155067_c1_258_686 116
5 3300005530 Ga0070679_101250101 Ga0070679_1012501012 120
6 iso_pu_bacteria 2643221587 2643943121 120
7 iso_pu_bacteria 2643221677 2644430581 120
8 iso_pu_bacteria 2918501144 2918508103 120
9 3300009147 Ga0114129_10300827 Ga0114129_103008272 122
10 3300031731 Ga0307405_10281567 Ga0307405_102815672 122
11 3300031995 Ga0307409_101804271 Ga0307409_1018042711 122
12 3300032126 Ga0307415_100085182 Ga0307415_1000851822 122
13 3300047472 Ga0495686_0021406 Ga0495686_0021406_1290_1676 122
14 3300049587 Ga0501071_0346039 Ga0501071_0346039_13_456 122
15 3300049743 Ga0501081_0317146 Ga0501081_0317146_604_972 122
16 3300050507 nmdc:mga05p37_1189579_c1 nmdc:mga05p37_1189579_c1_284_724 122
17 3300053087 Ga0500643_000072 Ga0500643_000072_9795_10199 122
18 3300053104 Ga0500556_0000001 Ga0500556_0000001_639149_639535 122
19 3300053126 Ga0500621_188902 Ga0500621_188902_118_504 122
20 3300053139 Ga0500568_0000006 Ga0500568_0000006_55085_55471 122
21 3300061734 Ga0530510_0383708 Ga0530510_0383708_357_800 122
22 3300005336 Ga0070680_100903017 Ga0070680_1009030171 123
23 3300005435 Ga0070714_101187920 Ga0070714_1011879202 123
24 3300005445 Ga0070708_100208334 Ga0070708_1002083342 123
25 3300005467 Ga0070706_100290743 Ga0070706_1002907432 123
26 3300005518 Ga0070699_100347019 Ga0070699_1003470193 123
27 3300005937 Ga0081455_10077060 Ga0081455_100770602 123
28 3300005985 Ga0081539_10088546 Ga0081539_100885464 123
29 3300006038 Ga0075365_10182555 Ga0075365_101825553 123
30 3300006038 Ga0075365_10707880 Ga0075365_107078801 123
31 3300006042 Ga0075368_10001135 Ga0075368_100011354 123
32 3300006048 Ga0075363_100008278 Ga0075363_1000082787 123
33 3300006051 Ga0075364_10001012 Ga0075364_1000101215 123
34 3300006051 Ga0075364_10900055 Ga0075364_109000552 123
35 3300006177 Ga0075362_10029759 Ga0075362_100297592 123
36 3300006178 Ga0075367_10026223 Ga0075367_100262234 123
37 3300006186 Ga0075369_10000181 Ga0075369_1000018110 123
38 3300006846 Ga0075430_100121626 Ga0075430_1001216263 123
39 3300006846 Ga0075430_100346419 Ga0075430_1003464192 123
40 3300006871 Ga0075434_100248160 Ga0075434_1002481602 123
41 3300006880 Ga0075429_100007850 Ga0075429_1000078503 123
42 3300006880 Ga0075429_101242859 Ga0075429_1012428592 123
43 3300007076 Ga0075435_100198709 Ga0075435_1001987091 123
44 3300009098 Ga0105245_10601200 Ga0105245_106012002 123
45 3300009147 Ga0114129_10048820 Ga0114129_100488202 123
46 3300009147 Ga0114129_10456607 Ga0114129_104566073 123
47 3300013296 Ga0157374_10908906 Ga0157374_109089062 123
48 3300013307 Ga0157372_12519553 Ga0157372_125195532 123
49 3300013308 Ga0157375_12233941 Ga0157375_122339412 123
50 3300025910 Ga0207684_10092420 Ga0207684_100924202 123
51 3300025927 Ga0207687_10386641 Ga0207687_103866412 123
52 3300025929 Ga0207664_10468368 Ga0207664_104683681 123
53 3300027866 Ga0209813_10039798 Ga0209813_100397982 123
54 3300028379 Ga0268266_10294718 Ga0268266_102947182 123
55 3300028573 Ga0265334_10193715 Ga0265334_101937151 123
56 3300028800 Ga0265338_10364889 Ga0265338_103648892 123
57 3300032002 Ga0307416_103685975 Ga0307416_1036859751 123
58 3300032126 Ga0307415_101986579 Ga0307415_1019865792 123
59 3300037418 Ga0395900_1739481 Ga0395900_1739481_145_522 123
60 3300041451 Ga0451791_1897080 Ga0451791_1897080_109_498 123
61 3300044694 Ga0466963_0036775 Ga0466963_0036775_1319_1705 123
62 3300045976 Ga0466967_0208077 Ga0466967_0208077_371_754 123
63 3300046674 Ga0495588_0200515 Ga0495588_0200515_82_471 123
64 3300048912 Ga0496109_0742530 Ga0496109_0742530_418_849 123
65 3300048915 Ga0496112_0162771 Ga0496112_0162771_1488_1868 123
66 3300048915 Ga0496112_0614851 Ga0496112_0614851_447_833 123
67 3300048917 Ga0496114_0487316 Ga0496114_0487316_397_777 123
68 3300048929 Ga0496126_0062259 Ga0496126_0062259_1062_1433 123
69 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_13994_14383 123
70 3300050492 nmdc:mga0yw44_457763_c1 nmdc:mga0yw44_457763_c1_208_636 123
71 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_333118_333507 123
72 3300050494 nmdc:mga06z11_8591_c1 nmdc:mga06z11_8591_c1_1738_2127 123
73 3300050495 nmdc:mga04h51_251_c1 nmdc:mga04h51_251_c1_507_896 123
74 3300050507 nmdc:mga05p37_462806_c1 nmdc:mga05p37_462806_c1_1062_1442 123
75 3300050507 nmdc:mga05p37_90316_c1 nmdc:mga05p37_90316_c1_150_521 123
76 3300050508 nmdc:mga09592_134445_c1 nmdc:mga09592_134445_c1_1341_1712 123
77 3300050508 nmdc:mga09592_714123_c1 nmdc:mga09592_714123_c1_105_485 123
78 3300050509 nmdc:mga0qj67_19367_c1 nmdc:mga0qj67_19367_c1_1849_2220 123
79 3300050510 nmdc:mga06r32_546422_c1 nmdc:mga06r32_546422_c1_153_524 123
80 3300050512 nmdc:mga0n895_255624_c1 nmdc:mga0n895_255624_c1_626_1006 123
81 3300050513 nmdc:mga0rr50_373125_c1 nmdc:mga0rr50_373125_c1_84_458 123
82 3300050515 nmdc:mga0a205_38108_c1 nmdc:mga0a205_38108_c1_3792_4172 123
83 3300053090 Ga0500646_0000005 Ga0500646_0000005_94013_94402 123
84 3300053092 Ga0500583_0040995 Ga0500583_0040995_1685_2074 123
85 3300053092 Ga0500583_0066950 Ga0500583_0066950_361_750 123
86 3300053096 Ga0500641_0000001 Ga0500641_0000001_1032131_1032520 123
87 3300053098 Ga0500650_0011791 Ga0500650_0011791_2109_2498 123
88 3300053131 Ga0500652_000001 Ga0500652_000001_449872_450261 123
89 3300053155 Ga0500620_004171 Ga0500620_004171_513_902 123
90 3300005341 Ga0070691_10061243 Ga0070691_100612432 124
91 3300005365 Ga0070688_100001412 Ga0070688_10000141212 124
92 3300005466 Ga0070685_10001592 Ga0070685_1000159212 124
93 3300005614 Ga0068856_100000210 Ga0068856_10000021011 124
94 3300005614 Ga0068856_100110436 Ga0068856_1001104362 124
95 3300005616 Ga0068852_100000983 Ga0068852_10000098313 124
96 3300005616 Ga0068852_100535462 Ga0068852_1005354622 124
97 3300005841 Ga0068863_100055760 Ga0068863_1000557607 124
98 3300006844 Ga0075428_100764133 Ga0075428_1007641332 124
99 3300006844 Ga0075428_100802353 Ga0075428_1008023532 124
100 3300006847 Ga0075431_102200228 Ga0075431_1022002281 124
101 3300009098 Ga0105245_10000012 Ga0105245_1000001257 124
102 3300009098 Ga0105245_10822627 Ga0105245_108226272 124
103 3300009147 Ga0114129_10463792 Ga0114129_104637922 124
104 3300009147 Ga0114129_13036923 Ga0114129_130369231 124
105 3300009176 Ga0105242_10000104 Ga0105242_1000010449 124
106 3300009177 Ga0105248_10000126 Ga0105248_1000012656 124
107 3300013104 Ga0157370_11238786 Ga0157370_112387861 124
108 3300013105 Ga0157369_10000135 Ga0157369_1000013583 124
109 3300013105 Ga0157369_10031039 Ga0157369_100310393 124
110 3300013296 Ga0157374_10132308 Ga0157374_101323082 124
111 3300013307 Ga0157372_10472522 Ga0157372_104725223 124
112 3300013308 Ga0157375_10045193 Ga0157375_100451933 124
113 3300020082 Ga0206353_11267052 Ga0206353_112670521 124
114 3300025927 Ga0207687_11465631 Ga0207687_114656311 124
115 3300025934 Ga0207686_10000063 Ga0207686_1000006331 124
116 3300025938 Ga0207704_10000009 Ga0207704_1000000928 124
117 3300025941 Ga0207711_10000024 Ga0207711_10000024168 124
118 3300026078 Ga0207702_10000099 Ga0207702_1000009914 124
119 3300026078 Ga0207702_10712303 Ga0207702_107123032 124
120 3300026088 Ga0207641_10011355 Ga0207641_100113552 124
121 3300026121 Ga0207683_11080223 Ga0207683_110802232 124
122 3300026142 Ga0207698_10000009 Ga0207698_1000000910 124
123 3300031852 Ga0307410_10409092 Ga0307410_104090922 124
124 3300031852 Ga0307410_10417938 Ga0307410_104179382 124
125 3300031901 Ga0307406_10213013 Ga0307406_102130132 124
126 3300031901 Ga0307406_10306589 Ga0307406_103065892 124
127 3300031911 Ga0307412_10801129 Ga0307412_108011291 124
128 3300031995 Ga0307409_100027813 Ga0307409_1000278133 124
129 3300031995 Ga0307409_100382688 Ga0307409_1003826882 124
130 3300032002 Ga0307416_100294664 Ga0307416_1002946642 124
131 3300032005 Ga0307411_10342837 Ga0307411_103428372 124
132 3300032005 Ga0307411_10856733 Ga0307411_108567332 124
133 3300032126 Ga0307415_100183462 Ga0307415_1001834622 124
134 3300032126 Ga0307415_100241939 Ga0307415_1002419391 124
135 3300037418 Ga0395900_0019276 Ga0395900_0019276_1451_1837 124
136 3300037466 Ga0395898_0078887 Ga0395898_0078887_1153_1539 124
137 3300038443 Ga0395901_0264223 Ga0395901_0264223_1169_1555 124
138 3300044683 Ga0466965_0394283 Ga0466965_0394283_220_597 124
139 3300044765 Ga0466970_0312209 Ga0466970_0312209_336_713 124
140 3300044842 Ga0466957_1422280 Ga0466957_1422280_110_487 124
141 3300044901 Ga0466960_0350970 Ga0466960_0350970_371_808 124
142 3300045836 Ga0466958_0257357 Ga0466958_0257357_523_957 124
143 3300045976 Ga0466967_0877325 Ga0466967_0877325_71_457 124
144 3300046459 Ga0495629_0009096 Ga0495629_0009096_5866_6246 124
145 3300046459 Ga0495629_0013866 Ga0495629_0013866_330_710 124
146 3300046517 Ga0495630_0643754 Ga0495630_0643754_241_621 124
147 3300048905 Ga0496102_0000045 Ga0496102_0000045_31370_31756 124
148 3300048906 Ga0496103_0000050 Ga0496103_0000050_120277_120663 124
149 3300048918 Ga0496115_0000071 Ga0496115_0000071_33295_33675 124
150 3300048920 Ga0496117_0235790 Ga0496117_0235790_186_572 124
151 3300049583 Ga0501067_0109473 Ga0501067_0109473_1118_1522 124
152 3300049584 Ga0501068_0552340 Ga0501068_0552340_228_629 124
153 3300049585 Ga0501069_0139427 Ga0501069_0139427_408_809 124
154 3300053083 Ga0495655_0000004 Ga0495655_0000004_193647_194027 124
155 3300053094 Ga0500566_0008381 Ga0500566_0008381_3255_3635 124
156 3300053129 Ga0500628_000004 Ga0500628_000004_102062_102442 124
157 3300053140 Ga0500573_0040846 Ga0500573_0040846_602_982 124
158 2149837012 _GD4IA4401BBAK3 LJQ_0019.00000030 125
159 3300031995 Ga0307409_101004209 Ga0307409_1010042092 125
160 3300032126 Ga0307415_101226564 Ga0307415_1012265642 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

147

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

37

148

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8072 4 125
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7906 6 125
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.779 4 124
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7773 4 125
4nb2-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7767 4 125
ID Description Score Start End Superfamily
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7897 4 124 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7834 4 124 3.10.180.10
af_I1KAC6_40_126_3.30.310.40 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein; 0.7794 100 122 3.30.310.40
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7776 4 125 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7691 4 125 3.10.180.10
ID Description Score Start End GO Terms
AF-Q0SHV7-F1-model_v4 Possible cell wall protein 0.9851 1 125
AF-K0EYG3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9838 1 124 GO:0051213
AF-A0A3G9M7N3-F1-model_v4 deleted 0.9811 1 125
AF-C1A0R7-F1-model_v4 VOC domain-containing protein 0.9794 1 125
AF-K0EYG3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9758 1 124 GO:0051213

Feature Viewer

pLDDT pTM Quality
93.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map