F234863

General Info

Members Datasets Scaffolds Average Seq Length
160 123 160 224

Family's Representative Sequence

Representative Sequence 3300028654|Ga0265322_10067510|Ga0265322_100675102
Length 242
Sequence MRRSIPTGLIFPPRTDSPRRMVPNQHELSKIYHRRFVRTAAYRNRVWEILTRKFFSRWVRPGDTVLDLGCGYGEFINNIPAATKWAMDLNPDAPRHLRPEVKFLHQDCSADWPLPDNSLDAVFTSNFFEHLPDKECLSRTLRHALRCLKPGGRLIALGPNIKFLHGEYWDFYDHHVYLTETSLGEAMEIEGYTIDVLRPRFLPFTMVSAPEYPMFFVHLYLALPWLWWVKGRQFLVIARKPA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 0.62
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10006496 3300003320 Unclassified 1617
2 rootH1_10040402 3300003323 Bacteria 6010
3 rootH1_10301012 3300003323 Unclassified 1813
4 Ga0070658_10044492 3300005327 Bacteria 3589
5 Ga0070683_100154829 3300005329 Bacteria 2174
6 Ga0070683_100179854 3300005329 Bacteria 2007
7 Ga0070690_100096999 3300005330 Unclassified 1949
8 Ga0070666_10064654 3300005335 Unclassified 2481
9 Ga0070680_100083389 3300005336 Bacteria 2640
10 Ga0068868_100112011 3300005338 Unclassified 2218
11 Ga0068868_100831419 3300005338 Unclassified 835
12 Ga0070689_100223548 3300005340 Unclassified 1545
13 Ga0070675_100008776 3300005354 Bacteria 7851
14 Ga0070675_100462153 3300005354 Bacteria 1139
15 Ga0070688_100026067 3300005365 Bacteria 3469
16 Ga0070714_100016561 3300005435 Bacteria 5957
17 Ga0070713_100004377 3300005436 Bacteria 9485
18 Ga0070710_10185578 3300005437 Unclassified 1305
19 Ga0070701_10034272 3300005438 Bacteria 2542
20 Ga0070711_100196845 3300005439 Unclassified 1552
21 Ga0070711_100213407 3300005439 Bacteria 1496
22 Ga0070662_100230402 3300005457 Bacteria 1482
23 Ga0070681_10240111 3300005458 Bacteria 1726
24 Ga0070681_10422303 3300005458 Bacteria 1245
25 Ga0070685_10062536 3300005466 Unclassified 2183
26 Ga0070685_10088629 3300005466 Bacteria 1869
27 Ga0070679_100000976 3300005530 Bacteria 24907
28 Ga0070679_100277088 3300005530 Bacteria 1630
29 Ga0070696_100294746 3300005546 Unclassified 1240
30 Ga0070693_100027414 3300005547 Bacteria 3088
31 Ga0070665_100000265 3300005548 Bacteria 85729
32 Ga0070664_100169482 3300005564 Unclassified 1936
33 Ga0068857_100010781 3300005577 Bacteria 7954
34 Ga0068857_101088764 3300005577 Bacteria 771
35 Ga0068856_100166249 3300005614 Unclassified 2217
36 Ga0068852_100297047 3300005616 Bacteria 1562
37 Ga0068859_100008757 3300005617 Bacteria 10219
38 Ga0068863_100541092 3300005841 Bacteria 1149
39 Ga0075365_10000314 3300006038 Bacteria 17047
40 Ga0070715_10438931 3300006163 Unclassified 734
41 Ga0070716_100181107 3300006173 Unclassified 1383
42 Ga0075362_10173984 3300006177 Unclassified 1041
43 Ga0097620_100008757 3300006931 Bacteria 10219
44 Ga0075435_100004037 3300007076 Bacteria 10036
45 Ga0105240_10001562 3300009093 Bacteria 38837
46 Ga0105240_10239551 3300009093 Bacteria 2104
47 Ga0105245_10230334 3300009098 Bacteria 1792
48 Ga0105241_10045469 3300009174 Bacteria 3331
49 Ga0105241_10052312 3300009174 Unclassified 3117
50 Ga0105248_10354475 3300009177 Bacteria 1652
51 Ga0105237_10036228 3300009545 Bacteria 4991
52 Ga0105237_10879970 3300009545 Unclassified 903
53 Ga0105238_10012316 3300009551 Bacteria 8624
54 Ga0105238_10147936 3300009551 Bacteria 2325
55 Ga0105238_10295979 3300009551 Bacteria 1602
56 Ga0105249_10612072 3300009553 Unclassified 1145
57 Ga0157369_10001642 3300013105 Bacteria 27289
58 Ga0157374_10090074 3300013296 Unclassified 2924
59 Ga0157372_10006864 3300013307 Bacteria 12115
60 Ga0157372_10011253 3300013307 Bacteria 9516
61 Ga0157372_10049868 3300013307 Unclassified 4657
62 Ga0157372_10112674 3300013307 Bacteria 3117
63 Ga0157372_10118816 3300013307 Bacteria 3034
64 Ga0157375_10000006 3300013308 Bacteria 384086
65 Ga0213876_10143548 3300021384 Unclassified 1270
66 Ga0213875_10000003 3300021388 Bacteria 719367
67 Ga0207680_10050224 3300025903 Unclassified 2487
68 Ga0207699_10058651 3300025906 Unclassified 2303
69 Ga0207654_10016488 3300025911 Bacteria 3848
70 Ga0207707_10096575 3300025912 Bacteria 2582
71 Ga0207707_10282768 3300025912 Bacteria 1437
72 Ga0207695_10060067 3300025913 Bacteria 3938
73 Ga0207671_10044723 3300025914 Bacteria 3274
74 Ga0207652_10001440 3300025921 Bacteria 21078
75 Ga0207652_10478392 3300025921 Bacteria 1122
76 Ga0207694_10013086 3300025924 Bacteria 6249
77 Ga0207694_10120165 3300025924 Unclassified 2097
78 Ga0207694_10585790 3300025924 Bacteria 938
79 Ga0207659_10037894 3300025926 Bacteria 3351
80 Ga0207687_10188763 3300025927 Bacteria 1602
81 Ga0207700_10126041 3300025928 Unclassified 2083
82 Ga0207664_10008709 3300025929 Bacteria 7093
83 Ga0207690_10127942 3300025932 Unclassified 1855
84 Ga0207670_10026527 3300025936 Bacteria 3652
85 Ga0207704_10786663 3300025938 Unclassified 794
86 Ga0207689_10255537 3300025942 Unclassified 1449
87 Ga0207661_10111683 3300025944 Bacteria 2313
88 Ga0207677_10155634 3300026023 Unclassified 1770
89 Ga0207676_10467276 3300026095 Bacteria 1192
90 Ga0207674_10001544 3300026116 Bacteria 29661
91 Ga0268266_10001881 3300028379 Bacteria 23712
92 Ga0265337_1008040 3300028556 Bacteria 3879
93 Ga0265318_10060987 3300028577 Bacteria 1405
94 Ga0265323_10000013 3300028653 Bacteria 107343
95 Ga0265322_10001273 3300028654 Bacteria 8492
96 Ga0265322_10067510 3300028654 Bacteria 1014
97 Ga0265336_10010861 3300028666 Bacteria 3108
98 Ga0265338_10067042 3300028800 Bacteria 3102
99 Ga0265338_10128703 3300028800 Bacteria 2004
100 Ga0265324_10000259 3300029957 Bacteria 39278
101 Ga0265320_10043433 3300031240 Bacteria 2222
102 Ga0265320_10079726 3300031240 Bacteria 1530
103 Ga0265325_10056310 3300031241 Bacteria 2008
104 Ga0265340_10033090 3300031247 Bacteria 2576
105 Ga0265316_10000485 3300031344 Bacteria 45047
106 Ga0265316_10238998 3300031344 Unclassified 1336
107 Ga0307408_100583159 3300031548 Bacteria 991
108 Ga0307508_10000129 3300031616 Bacteria 89267
109 Ga0265314_10048441 3300031711 Unclassified 2983
110 Ga0265342_10011237 3300031712 Bacteria 6142
111 Ga0265342_10132234 3300031712 Bacteria 1397
112 Ga0307409_100092146 3300031995 Bacteria 2486
113 Ga0307414_10577738 3300032004 Unclassified 1005
114 Ga0307411_10177255 3300032005 Bacteria 1614
115 Ga0307415_100092615 3300032126 Unclassified 2192
116 Ga0307415_100309037 3300032126 Bacteria 1313
117 Ga0373957_0326112 3300035120 Unclassified 653
118 Ga0373946_0006747 3300035171 Bacteria 4171
119 Ga0373935_0012713 3300035692 Bacteria 5067
120 Ga0373935_0689227 3300035692 Unclassified 751
121 Ga0373927_0059544 3300035695 Bacteria 2470
122 Ga0373947_0001965 3300035725 Bacteria 12587
123 Ga0373947_0073519 3300035725 Bacteria 2101
124 Ga0373925_0005125 3300037068 Bacteria 9816
125 Ga0395901_0349647 3300038443 Bacteria 1526
126 Ga0436365_0137067 3300039437 Bacteria 2092
127 Ga0436365_1480210 3300039437 Bacteria 6404
128 Ga0436360_0145306 3300039438 Unclassified 1152
129 Ga0436363_1437287 3300039450 Unclassified 1442
130 Ga0451577_0324863 3300042876 Unclassified 1395
131 Ga0453684_0000734 3300044712 Bacteria 114826
132 Ga0453684_0061326 3300044712 Bacteria 4828
133 Ga0453684_0076687 3300044712 Bacteria 4195
134 Ga0451576_0114709 3300045051 Bacteria 2805
135 Ga0451576_0330371 3300045051 Unclassified 1596
136 Ga0495580_0016267 3300046472 Bacteria 5587
137 Ga0495582_0014684 3300046473 Unclassified 4304
138 Ga0495662_0206988 3300046476 Bacteria 967
139 Ga0495630_0000076 3300046517 Bacteria 77289
140 Ga0495630_0020376 3300046517 Bacteria 4889
141 Ga0495666_0011694 3300046526 Bacteria 4376
142 Ga0495666_0019310 3300046526 Bacteria 3384
143 Ga0495640_0038666 3300046533 Bacteria 3355
144 Ga0495586_0000001 3300046535 Bacteria 231314
145 Ga0495634_0002733 3300046642 Bacteria 14507
146 Ga0495647_0044302 3300046681 Bacteria 1706
147 Ga0495613_0009597 3300046689 Bacteria 7189
148 Ga0495581_0206006 3300047315 Bacteria 1150
149 Ga0495674_0000207 3300047319 Bacteria 48305
150 Ga0495676_0016423 3300047321 Bacteria 6571
151 Ga0496115_0009073 3300048918 Bacteria 7379
152 Ga0501067_0005521 3300049583 Bacteria 7009
153 Ga0501070_0028532 3300049586 Bacteria 4682
154 Ga0501035_0062776 3300049822 Bacteria 3305
155 nmdc:mga0yw44_5706_c1 3300050492 Bacteria 5928
156 nmdc:mga08y16_269690_c1 3300050511 Bacteria 1757
157 nmdc:mga0rr50_52665_c1 3300050513 Bacteria 3025
158 nmdc:mga08x19_110895_c1 3300050514 Bacteria 1830
159 nmdc:mga08x19_140190_c1 3300050514 Bacteria 1633
160 Ga0500616_0001848 3300053153 Bacteria 19175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100169482 Ga0070664_1001694822 194
2 3300013105 Ga0157369_10001642 Ga0157369_1000164226 194
3 3300013296 Ga0157374_10090074 Ga0157374_100900742 194
4 3300013307 Ga0157372_10112674 Ga0157372_101126744 194
5 3300025932 Ga0207690_10127942 Ga0207690_101279422 194
6 3300048918 Ga0496115_0009073 Ga0496115_0009073_6385_6969 194
7 3300044712 Ga0453684_0000734 Ga0453684_0000734_84247_84909 202
8 3300035120 Ga0373957_0326112 Ga0373957_0326112_32_643 203
9 3300038443 Ga0395901_0349647 Ga0395901_0349647_776_1396 206
10 3300031548 Ga0307408_100583159 Ga0307408_1005831592 210
11 3300031995 Ga0307409_100092146 Ga0307409_1000921463 210
12 3300032004 Ga0307414_10577738 Ga0307414_105777381 210
13 3300032005 Ga0307411_10177255 Ga0307411_101772553 210
14 3300032126 Ga0307415_100092615 Ga0307415_1000926152 210
15 3300032126 Ga0307415_100309037 Ga0307415_1003090372 210
16 3300005546 Ga0070696_100294746 Ga0070696_1002947462 211
17 3300005336 Ga0070680_100083389 Ga0070680_1000833892 217
18 3300005458 Ga0070681_10422303 Ga0070681_104223032 217
19 3300005530 Ga0070679_100000976 Ga0070679_1000009767 217
20 3300009545 Ga0105237_10036228 Ga0105237_100362284 217
21 3300025914 Ga0207671_10044723 Ga0207671_100447231 217
22 3300025921 Ga0207652_10001440 Ga0207652_100014406 217
23 3300031240 Ga0265320_10043433 Ga0265320_100434333 217
24 3300042876 Ga0451577_0324863 Ga0451577_0324863_578_1243 217
25 3300044712 Ga0453684_0076687 Ga0453684_0076687_182_847 217
26 3300005435 Ga0070714_100016561 Ga0070714_1000165613 218
27 3300005436 Ga0070713_100004377 Ga0070713_1000043773 218
28 3300005437 Ga0070710_10185578 Ga0070710_101855782 218
29 3300005439 Ga0070711_100196845 Ga0070711_1001968452 218
30 3300007076 Ga0075435_100004037 Ga0075435_1000040376 218
31 3300021388 Ga0213875_10000003 Ga0213875_10000003361 218
32 3300025906 Ga0207699_10058651 Ga0207699_100586512 218
33 3300025928 Ga0207700_10126041 Ga0207700_101260413 218
34 3300025929 Ga0207664_10008709 Ga0207664_100087094 218
35 3300039438 Ga0436360_0145306 Ga0436360_0145306_462_1136 218
36 3300039450 Ga0436363_1437287 Ga0436363_1437287_694_1371 218
37 3300050513 nmdc:mga0rr50_52665_c1 nmdc:mga0rr50_52665_c1_920_1576 218
38 3300050514 nmdc:mga08x19_110895_c1 nmdc:mga08x19_110895_c1_751_1407 218
39 3300050514 nmdc:mga08x19_140190_c1 nmdc:mga08x19_140190_c1_717_1373 218
40 3300025938 Ga0207704_10786663 Ga0207704_107866631 220
41 3300005329 Ga0070683_100179854 Ga0070683_1001798542 221
42 3300005338 Ga0068868_100831419 Ga0068868_1008314191 221
43 3300005439 Ga0070711_100213407 Ga0070711_1002134073 221
44 3300005458 Ga0070681_10240111 Ga0070681_102401112 221
45 3300005530 Ga0070679_100277088 Ga0070679_1002770882 221
46 3300005547 Ga0070693_100027414 Ga0070693_1000274143 221
47 3300005577 Ga0068857_100010781 Ga0068857_1000107817 221
48 3300005577 Ga0068857_101088764 Ga0068857_1010887641 221
49 3300005616 Ga0068852_100297047 Ga0068852_1002970471 221
50 3300006038 Ga0075365_10000314 Ga0075365_100003143 221
51 3300006163 Ga0070715_10438931 Ga0070715_104389311 221
52 3300006177 Ga0075362_10173984 Ga0075362_101739842 221
53 3300009093 Ga0105240_10001562 Ga0105240_1000156213 221
54 3300009093 Ga0105240_10239551 Ga0105240_102395512 221
55 3300009098 Ga0105245_10230334 Ga0105245_102303342 221
56 3300009174 Ga0105241_10045469 Ga0105241_100454694 221
57 3300009545 Ga0105237_10879970 Ga0105237_108799702 221
58 3300009551 Ga0105238_10295979 Ga0105238_102959792 221
59 3300013307 Ga0157372_10006864 Ga0157372_100068649 221
60 3300025911 Ga0207654_10016488 Ga0207654_100164882 221
61 3300025912 Ga0207707_10096575 Ga0207707_100965752 221
62 3300025913 Ga0207695_10060067 Ga0207695_100600672 221
63 3300025921 Ga0207652_10478392 Ga0207652_104783922 221
64 3300025924 Ga0207694_10013086 Ga0207694_100130862 221
65 3300025927 Ga0207687_10188763 Ga0207687_101887631 221
66 3300026116 Ga0207674_10001544 Ga0207674_1000154424 221
67 3300031711 Ga0265314_10048441 Ga0265314_100484412 221
68 3300035171 Ga0373946_0006747 Ga0373946_0006747_119_784 221
69 3300035692 Ga0373935_0012713 Ga0373935_0012713_3916_4581 221
70 3300035692 Ga0373935_0689227 Ga0373935_0689227_20_703 221
71 3300035695 Ga0373927_0059544 Ga0373927_0059544_1027_1692 221
72 3300035725 Ga0373947_0001965 Ga0373947_0001965_10181_10846 221
73 3300035725 Ga0373947_0073519 Ga0373947_0073519_67_750 221
74 3300037068 Ga0373925_0005125 Ga0373925_0005125_6431_7096 221
75 3300039437 Ga0436365_0137067 Ga0436365_0137067_341_1021 221
76 3300046473 Ga0495582_0014684 Ga0495582_0014684_2954_3673 221
77 3300046476 Ga0495662_0206988 Ga0495662_0206988_127_846 221
78 3300046517 Ga0495630_0000076 Ga0495630_0000076_67972_68691 221
79 3300046517 Ga0495630_0020376 Ga0495630_0020376_2171_2836 221
80 3300046526 Ga0495666_0011694 Ga0495666_0011694_3546_4265 221
81 3300046526 Ga0495666_0019310 Ga0495666_0019310_2228_2893 221
82 3300046533 Ga0495640_0038666 Ga0495640_0038666_2008_2727 221
83 3300046535 Ga0495586_0000001 Ga0495586_0000001_67971_68690 221
84 3300046642 Ga0495634_0002733 Ga0495634_0002733_13380_14099 221
85 3300046681 Ga0495647_0044302 Ga0495647_0044302_123_842 221
86 3300046689 Ga0495613_0009597 Ga0495613_0009597_5199_5918 221
87 3300047315 Ga0495581_0206006 Ga0495581_0206006_134_799 221
88 3300047319 Ga0495674_0000207 Ga0495674_0000207_16505_17224 221
89 3300047321 Ga0495676_0016423 Ga0495676_0016423_5718_6437 221
90 3300049586 Ga0501070_0028532 Ga0501070_0028532_267_941 221
91 3300049822 Ga0501035_0062776 Ga0501035_0062776_1648_2322 221
92 3300050492 nmdc:mga0yw44_5706_c1 nmdc:mga0yw44_5706_c1_1910_2593 221
93 3300003320 rootH2_10006496 rootH2_100064962 222
94 3300003323 rootH1_10040402 rootH1_100404024 222
95 3300003323 rootH1_10301012 rootH1_103010122 222
96 3300005327 Ga0070658_10044492 Ga0070658_100444924 222
97 3300005329 Ga0070683_100154829 Ga0070683_1001548293 222
98 3300005330 Ga0070690_100096999 Ga0070690_1000969992 222
99 3300005335 Ga0070666_10064654 Ga0070666_100646543 222
100 3300005338 Ga0068868_100112011 Ga0068868_1001120112 222
101 3300005340 Ga0070689_100223548 Ga0070689_1002235482 222
102 3300005354 Ga0070675_100008776 Ga0070675_1000087763 222
103 3300005354 Ga0070675_100462153 Ga0070675_1004621532 222
104 3300005365 Ga0070688_100026067 Ga0070688_1000260672 222
105 3300005438 Ga0070701_10034272 Ga0070701_100342722 222
106 3300005457 Ga0070662_100230402 Ga0070662_1002304021 222
107 3300005466 Ga0070685_10062536 Ga0070685_100625362 222
108 3300005466 Ga0070685_10088629 Ga0070685_100886292 222
109 3300005548 Ga0070665_100000265 Ga0070665_10000026554 222
110 3300005614 Ga0068856_100166249 Ga0068856_1001662492 222
111 3300005617 Ga0068859_100008757 Ga0068859_1000087573 222
112 3300005841 Ga0068863_100541092 Ga0068863_1005410922 222
113 3300006173 Ga0070716_100181107 Ga0070716_1001811072 222
114 3300006931 Ga0097620_100008757 Ga0097620_1000087573 222
115 3300009174 Ga0105241_10052312 Ga0105241_100523122 222
116 3300009177 Ga0105248_10354475 Ga0105248_103544752 222
117 3300009551 Ga0105238_10012316 Ga0105238_100123166 222
118 3300009551 Ga0105238_10147936 Ga0105238_101479362 222
119 3300009553 Ga0105249_10612072 Ga0105249_106120721 222
120 3300013307 Ga0157372_10011253 Ga0157372_100112532 222
121 3300013307 Ga0157372_10049868 Ga0157372_100498683 222
122 3300013307 Ga0157372_10118816 Ga0157372_101188162 222
123 3300013308 Ga0157375_10000006 Ga0157375_100000067 222
124 3300021384 Ga0213876_10143548 Ga0213876_101435481 222
125 3300025903 Ga0207680_10050224 Ga0207680_100502243 222
126 3300025912 Ga0207707_10282768 Ga0207707_102827682 222
127 3300025924 Ga0207694_10120165 Ga0207694_101201652 222
128 3300025924 Ga0207694_10585790 Ga0207694_105857902 222
129 3300025926 Ga0207659_10037894 Ga0207659_100378942 222
130 3300025936 Ga0207670_10026527 Ga0207670_100265273 222
131 3300025942 Ga0207689_10255537 Ga0207689_102555372 222
132 3300025944 Ga0207661_10111683 Ga0207661_101116833 222
133 3300026023 Ga0207677_10155634 Ga0207677_101556342 222
134 3300026095 Ga0207676_10467276 Ga0207676_104672761 222
135 3300028379 Ga0268266_10001881 Ga0268266_1000188126 222
136 3300028556 Ga0265337_1008040 Ga0265337_10080402 222
137 3300028577 Ga0265318_10060987 Ga0265318_100609872 222
138 3300028653 Ga0265323_10000013 Ga0265323_1000001342 222
139 3300028654 Ga0265322_10001273 Ga0265322_100012733 222
140 3300028654 Ga0265322_10067510 Ga0265322_100675102 222
141 3300028666 Ga0265336_10010861 Ga0265336_100108612 222
142 3300028800 Ga0265338_10067042 Ga0265338_100670424 222
143 3300028800 Ga0265338_10128703 Ga0265338_101287032 222
144 3300029957 Ga0265324_10000259 Ga0265324_1000025925 222
145 3300031240 Ga0265320_10079726 Ga0265320_100797262 222
146 3300031241 Ga0265325_10056310 Ga0265325_100563102 222
147 3300031247 Ga0265340_10033090 Ga0265340_100330903 222
148 3300031344 Ga0265316_10000485 Ga0265316_1000048531 222
149 3300031344 Ga0265316_10238998 Ga0265316_102389982 222
150 3300031616 Ga0307508_10000129 Ga0307508_1000012958 222
151 3300031712 Ga0265342_10011237 Ga0265342_100112376 222
152 3300031712 Ga0265342_10132234 Ga0265342_101322342 222
153 3300039437 Ga0436365_1480210 Ga0436365_1480210_5076_5759 222
154 3300044712 Ga0453684_0061326 Ga0453684_0061326_2351_3022 222
155 3300045051 Ga0451576_0114709 Ga0451576_0114709_1598_2269 222
156 3300045051 Ga0451576_0330371 Ga0451576_0330371_658_1326 222
157 3300046472 Ga0495580_0016267 Ga0495580_0016267_1189_1866 222
158 3300049583 Ga0501067_0005521 Ga0501067_0005521_4701_5381 222
159 3300050511 nmdc:mga08y16_269690_c1 nmdc:mga08y16_269690_c1_613_1311 222
160 3300053153 Ga0500616_0001848 Ga0500616_0001848_15568_16245 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

66

156

0.89

PF13649

Methyltransf_25

Methyltransferase domain

65

152

0.89

PF13489

Methyltransf_23

Methyltransferase domain

33

197

0.87

PF08242

Methyltransf_12

Methyltransferase domain

66

154

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bxo-assembly1.cif.gz_B crystal structure of streptomyces venezuelae desvi 0.8105 14 136
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.7858 27 220
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.769 35 222
7q2g-assembly1.cif.gz_A mycolic acid methyltransferase hma (mmaa4) from mycobac-terium tuberculosis in complex with zt726 0.7634 39 177
2xva-assembly3.cif.gz_C crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin 0.762 36 220
ID Description Score Start End Superfamily
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8818 35 134 3.40.50.150
af_A4IBB6_84_475_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8756 93 139 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8742 35 134 3.40.50.150
af_I1N7H2_105_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8591 62 136 3.40.50.150
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8524 35 147 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1V5KXG9-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9944 21 222 GO:0008757
AF-A0A317IN54-F1-model_v4 Class I SAM-dependent methyltransferase 0.9907 4 222 GO:0008757
GO:0032259
AF-A0A2V6C0C1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9853 1 222 GO:0008168
GO:0032259
AF-K2DXC0-F1-model_v4 Methyltransferase type 11 0.9819 8 220 GO:0008168
GO:0032259
AF-X8FNR4-F1-model_v4 deleted 0.9812 46 132

Feature Viewer

pLDDT pTM Quality
89.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map