F236174

General Info

Members Datasets Scaffolds Average Seq Length
161 124 322 273

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10000027|Ga0070677_100000275
Length 284
Sequence MVPDPSQAYGWRVPATIETGELRVDGVRAFFRRVPGEGTPTVYCHGNPTHGEDWLPFLERGGPAIAIDMPGWGRSDRPDPTRFDYSMYGLSDFLDKCLEELGVDRHKLVVHDWGSLALIGAQRRPERVEKLVVINAVPLLPGYRWHWVAQLWRRKPIGEVLNRTTTRAGLDLLLRQATGDRRPMPTAFVEMIWNHWNPGTQDALLALYRHADPDRLARAGWALGKLSCPALVLWGDRDPYLPTRFAQAYADALPAAELEVVPGAAHWPWIDDARLIERILRFLA

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 14.29
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10000027 3300005333 Bacteria 43465
2 JGI24740J21852_10000392 3300001979 Bacteria 18771
3 Ga0070683_100015069 3300005329 Bacteria 6783
4 Ga0070682_100000057 3300005337 Bacteria 108832
5 Ga0068868_100010651 3300005338 Bacteria 6664
6 Ga0070691_10000497 3300005341 Bacteria 14780
7 Ga0070691_10079595 3300005341 Bacteria 1602
8 Ga0070674_100000003 3300005356 Bacteria 258221
9 Ga0070673_100010571 3300005364 Bacteria 6253
10 Ga0070659_100081460 3300005366 Bacteria 2585
11 Ga0070667_100057382 3300005367 Bacteria 3291
12 Ga0070663_100246976 3300005455 Bacteria 1411
13 Ga0070678_100158744 3300005456 Bacteria 1830
14 Ga0068867_100000254 3300005459 Bacteria 35276
15 Ga0070684_100147260 3300005535 Bacteria 2132
16 Ga0068853_100014171 3300005539 Bacteria 6527
17 Ga0070686_100135113 3300005544 Unclassified 1710
18 Ga0070695_100111365 3300005545 Bacteria 1858
19 Ga0070665_100000159 3300005548 Bacteria 122613
20 Ga0070665_100231700 3300005548 Bacteria 1847
21 Ga0070665_100746296 3300005548 Bacteria 992
22 Ga0068856_100038565 3300005614 Bacteria 4690
23 Ga0068864_100000066 3300005618 Bacteria 116383
24 Ga0068866_10000002 3300005718 Bacteria 394090
25 Ga0068866_10013681 3300005718 Bacteria 3567
26 Ga0068861_100046402 3300005719 Bacteria 3275
27 Ga0068858_100000049 3300005842 Bacteria 122693
28 Ga0081539_10001602 3300005985 Bacteria 37290
29 Ga0070715_10000012 3300006163 Bacteria 173731
30 Ga0070716_100088956 3300006173 Bacteria 1864
31 Ga0075433_10048147 3300006852 Bacteria 3707
32 Ga0075434_100281677 3300006871 Unclassified 1682
33 Ga0105245_10001248 3300009098 Bacteria 22969
34 Ga0105245_10001267 3300009098 Bacteria 22830
35 Ga0105247_10000208 3300009101 Bacteria 56889
36 Ga0105242_10001420 3300009176 Bacteria 18882
37 Ga0105238_10000028 3300009551 Bacteria 188361
38 Ga0105249_10000192 3300009553 Bacteria 69997
39 Ga0105249_10077916 3300009553 Bacteria 3074
40 Ga0105246_10142543 3300011119 Bacteria 1804
41 Ga0157370_10006452 3300013104 Bacteria 12942
42 Ga0157378_10015777 3300013297 Bacteria 6615
43 Ga0163162_10677092 3300013306 Unclassified 1154
44 Ga0157375_10000322 3300013308 Bacteria 42941
45 Ga0157375_10004774 3300013308 Bacteria 11779
46 Ga0163163_10108551 3300014325 Bacteria 2802
47 Ga0157379_10017712 3300014968 Bacteria 6276
48 Ga0157379_10036963 3300014968 Bacteria 4353
49 Ga0163161_10038540 3300017792 Bacteria 3428
50 Ga0207682_10000003 3300025893 Bacteria 128548
51 Ga0207642_10000001 3300025899 Bacteria 714030
52 Ga0207642_10000003 3300025899 Bacteria 650651
53 Ga0207642_10000004 3300025899 Bacteria 407822
54 Ga0207642_10005361 3300025899 Bacteria 4180
55 Ga0207710_10000112 3300025900 Bacteria 103005
56 Ga0207685_10000001 3300025905 Bacteria 604473
57 Ga0207694_10000008 3300025924 Bacteria 484902
58 Ga0207687_10000012 3300025927 Bacteria 370729
59 Ga0207687_10000613 3300025927 Bacteria 24053
60 Ga0207686_10000418 3300025934 Bacteria 28994
61 Ga0207670_10062395 3300025936 Bacteria 2547
62 Ga0207669_10000023 3300025937 Bacteria 96638
63 Ga0207665_10275027 3300025939 Bacteria 1252
64 Ga0207661_10035386 3300025944 Bacteria 3891
65 Ga0207712_10000003 3300025961 Bacteria 615314
66 Ga0207712_10039232 3300025961 Bacteria 3243
67 Ga0207677_10001351 3300026023 Bacteria 13129
68 Ga0207703_10000132 3300026035 Bacteria 90163
69 Ga0207639_10004562 3300026041 Bacteria 9330
70 Ga0207708_10198752 3300026075 Bacteria 1599
71 Ga0207702_10042234 3300026078 Bacteria 3825
72 Ga0207648_10001595 3300026089 Bacteria 24839
73 Ga0207676_10000038 3300026095 Bacteria 171492
74 Ga0207675_100068036 3300026118 Bacteria 3329
75 Ga0207683_10107427 3300026121 Bacteria 2497
76 Ga0268266_10000023 3300028379 Bacteria 501899
77 Ga0268266_10072375 3300028379 Bacteria 2989
78 Ga0268266_10637524 3300028379 Bacteria 1025
79 Ga0268264_10139937 3300028381 Bacteria 2157
80 Ga0265337_1000054 3300028556 Bacteria 52183
81 Ga0265326_10000027 3300028558 Bacteria 110843
82 Ga0265322_10000003 3300028654 Bacteria 468671
83 Ga0265336_10005395 3300028666 Bacteria 4722
84 Ga0265324_10000103 3300029957 Bacteria 67507
85 Ga0265328_10103665 3300031239 Unclassified 1054
86 Ga0265320_10000001 3300031240 Bacteria 847191
87 Ga0265331_10001895 3300031250 Bacteria 14686
88 Ga0265327_10000003 3300031251 Bacteria 852750
89 Ga0265314_10001375 3300031711 Bacteria 27314
90 Ga0265342_10030768 3300031712 Bacteria 3323
91 Ga0373937_0048524 3300036401 Bacteria 3887
92 Ga0373937_0058018 3300036401 Bacteria 3556
93 Ga0373937_0519593 3300036401 Unclassified 1131
94 Ga0451853_2464716 3300041512 Bacteria 4167
95 Ga0495592_0008905 3300046454 Bacteria 7538
96 Ga0495603_0000291 3300046455 Bacteria 26643
97 Ga0495603_0000652 3300046455 Bacteria 19597
98 Ga0495629_0393600 3300046459 Bacteria 942
99 Ga0495638_0044995 3300046460 Bacteria 2779
100 Ga0495641_0000012 3300046461 Bacteria 144818
101 Ga0495608_0032425 3300046511 Bacteria 3531
102 Ga0495620_0000446 3300046515 Bacteria 27496
103 Ga0495628_0069383 3300046516 Bacteria 2749
104 Ga0495628_0124831 3300046516 Unclassified 1972
105 Ga0495630_0181817 3300046517 Unclassified 1603
106 Ga0495644_0001381 3300046523 Bacteria 9921
107 Ga0495598_0089227 3300046537 Unclassified 1002
108 Ga0495667_0117388 3300046559 Bacteria 1719
109 Ga0495625_0000319 3300046660 Bacteria 73241
110 Ga0495669_0000074 3300046684 Bacteria 66373
111 Ga0495613_0040024 3300046689 Unclassified 3474
112 Ga0495649_0005045 3300046694 Bacteria 8487
113 Ga0495600_0127563 3300046809 Bacteria 1654
114 Ga0495604_0309652 3300047317 Bacteria 1058
115 Ga0495672_0151385 3300047320 Unclassified 1203
116 Ga0495676_0001046 3300047321 Bacteria 23385
117 Ga0495676_0262500 3300047321 Unclassified 1174
118 Ga0495680_0000255 3300047322 Bacteria 58745
119 Ga0495680_0033834 3300047322 Bacteria 4135
120 Ga0495680_0041849 3300047322 Bacteria 3639
121 Ga0495680_0095159 3300047322 Unclassified 2227
122 Ga0495685_042011 3300047447 Bacteria 1561
123 Ga0495593_0230214 3300047673 Unclassified 929
124 Ga0496100_0000016 3300048903 Bacteria 166058
125 Ga0496101_0000038 3300048904 Bacteria 166058
126 Ga0496104_0000003 3300048907 Bacteria 669219
127 Ga0496104_0000007 3300048907 Bacteria 524804
128 Ga0496104_0457752 3300048907 Bacteria 1187
129 Ga0496104_0531009 3300048907 Bacteria 1087
130 Ga0496105_0000002 3300048908 Bacteria 753215
131 Ga0496105_0000008 3300048908 Bacteria 335652
132 Ga0496105_0000054 3300048908 Bacteria 89081
133 Ga0496105_0012717 3300048908 Bacteria 6666
134 Ga0496106_0000013 3300048909 Bacteria 202263
135 Ga0496106_0000027 3300048909 Bacteria 149560
136 Ga0496107_0000003 3300048910 Bacteria 304038
137 Ga0496107_0017078 3300048910 Bacteria 5102
138 Ga0496108_0000002 3300048911 Bacteria 700890
139 Ga0496108_0000216 3300048911 Bacteria 52702
140 Ga0496108_0071251 3300048911 Unclassified 2932
141 Ga0496109_0000001 3300048912 Bacteria 700852
142 Ga0496109_0000195 3300048912 Bacteria 60380
143 Ga0496109_0758925 3300048912 Bacteria 908
144 Ga0496111_0065068 3300048914 Bacteria 2646
145 Ga0496114_0178166 3300048917 Bacteria 1855
146 Ga0496115_0091142 3300048918 Bacteria 2491
147 Ga0496119_0013117 3300048922 Bacteria 6637
148 Ga0496125_0105970 3300048928 Bacteria 2053
149 Ga0501039_0163116 3300049575 Bacteria 1752
150 Ga0501042_0048403 3300049578 Bacteria 3031
151 Ga0501042_0093168 3300049578 Unclassified 2163
152 Ga0501072_0107930 3300049588 Bacteria 2214
153 Ga0501081_0132508 3300049743 Bacteria 1782
154 nmdc:mga0n895_200957_c2 3300050512 Unclassified 1714
155 nmdc:mga0a205_124_c2 3300050515 Bacteria 20732
156 Ga0495601_0000080 3300053077 Bacteria 51518
157 Ga0495601_0393215 3300053077 Bacteria 899
158 Ga0495612_0007263 3300053078 Bacteria 4533
159 Ga0495619_0012792 3300053085 Bacteria 5283
160 Ga0500641_0003500 3300053096 Bacteria 5547
161 Ga0500614_000932 3300053123 Bacteria 7299
162 Ga0070677_10000027
163 JGI24740J21852_10000392
164 Ga0070683_100015069
165 Ga0070682_100000057
166 Ga0068868_100010651
167 Ga0070691_10000497
168 Ga0070691_10079595
169 Ga0070674_100000003
170 Ga0070673_100010571
171 Ga0070659_100081460
172 Ga0070667_100057382
173 Ga0070663_100246976
174 Ga0070678_100158744
175 Ga0068867_100000254
176 Ga0070684_100147260
177 Ga0068853_100014171
178 Ga0070686_100135113
179 Ga0070695_100111365
180 Ga0070665_100000159
181 Ga0070665_100231700
182 Ga0070665_100746296
183 Ga0068856_100038565
184 Ga0068864_100000066
185 Ga0068866_10000002
186 Ga0068866_10013681
187 Ga0068861_100046402
188 Ga0068858_100000049
189 Ga0081539_10001602
190 Ga0070715_10000012
191 Ga0070716_100088956
192 Ga0075433_10048147
193 Ga0075434_100281677
194 Ga0105245_10001248
195 Ga0105245_10001267
196 Ga0105247_10000208
197 Ga0105242_10001420
198 Ga0105238_10000028
199 Ga0105249_10000192
200 Ga0105249_10077916
201 Ga0105246_10142543
202 Ga0157370_10006452
203 Ga0157378_10015777
204 Ga0163162_10677092
205 Ga0157375_10000322
206 Ga0157375_10004774
207 Ga0163163_10108551
208 Ga0157379_10017712
209 Ga0157379_10036963
210 Ga0163161_10038540
211 Ga0207682_10000003
212 Ga0207642_10000001
213 Ga0207642_10000003
214 Ga0207642_10000004
215 Ga0207642_10005361
216 Ga0207710_10000112
217 Ga0207685_10000001
218 Ga0207694_10000008
219 Ga0207687_10000012
220 Ga0207687_10000613
221 Ga0207686_10000418
222 Ga0207670_10062395
223 Ga0207669_10000023
224 Ga0207665_10275027
225 Ga0207661_10035386
226 Ga0207712_10000003
227 Ga0207712_10039232
228 Ga0207677_10001351
229 Ga0207703_10000132
230 Ga0207639_10004562
231 Ga0207708_10198752
232 Ga0207702_10042234
233 Ga0207648_10001595
234 Ga0207676_10000038
235 Ga0207675_100068036
236 Ga0207683_10107427
237 Ga0268266_10000023
238 Ga0268266_10072375
239 Ga0268266_10637524
240 Ga0268264_10139937
241 Ga0265337_1000054
242 Ga0265326_10000027
243 Ga0265322_10000003
244 Ga0265336_10005395
245 Ga0265324_10000103
246 Ga0265328_10103665
247 Ga0265320_10000001
248 Ga0265331_10001895
249 Ga0265327_10000003
250 Ga0265314_10001375
251 Ga0265342_10030768
252 Ga0373937_0048524
253 Ga0373937_0058018
254 Ga0373937_0519593
255 Ga0451853_2464716
256 Ga0495592_0008905
257 Ga0495603_0000291
258 Ga0495603_0000652
259 Ga0495629_0393600
260 Ga0495638_0044995
261 Ga0495641_0000012
262 Ga0495608_0032425
263 Ga0495620_0000446
264 Ga0495628_0069383
265 Ga0495628_0124831
266 Ga0495630_0181817
267 Ga0495644_0001381
268 Ga0495598_0089227
269 Ga0495667_0117388
270 Ga0495625_0000319
271 Ga0495669_0000074
272 Ga0495613_0040024
273 Ga0495649_0005045
274 Ga0495600_0127563
275 Ga0495604_0309652
276 Ga0495672_0151385
277 Ga0495676_0001046
278 Ga0495676_0262500
279 Ga0495680_0000255
280 Ga0495680_0033834
281 Ga0495680_0041849
282 Ga0495680_0095159
283 Ga0495685_042011
284 Ga0495593_0230214
285 Ga0496100_0000016
286 Ga0496101_0000038
287 Ga0496104_0000003
288 Ga0496104_0000007
289 Ga0496104_0457752
290 Ga0496104_0531009
291 Ga0496105_0000002
292 Ga0496105_0000008
293 Ga0496105_0000054
294 Ga0496105_0012717
295 Ga0496106_0000013
296 Ga0496106_0000027
297 Ga0496107_0000003
298 Ga0496107_0017078
299 Ga0496108_0000002
300 Ga0496108_0000216
301 Ga0496108_0071251
302 Ga0496109_0000001
303 Ga0496109_0000195
304 Ga0496109_0758925
305 Ga0496111_0065068
306 Ga0496114_0178166
307 Ga0496115_0091142
308 Ga0496119_0013117
309 Ga0496125_0105970
310 Ga0501039_0163116
311 Ga0501042_0048403
312 Ga0501042_0093168
313 Ga0501072_0107930
314 Ga0501081_0132508
315 nmdc:mga0n895_200957_c2
316 nmdc:mga0a205_124_c2
317 Ga0495601_0000080
318 Ga0495601_0393215
319 Ga0495612_0007263
320 Ga0495619_0012792
321 Ga0500641_0003500
322 Ga0500614_000932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

39

273

0.91

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

41

278

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8884 4 125
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8872 4 125
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8872 4 125
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8869 4 125
8ooh-assembly1.cif.gz_A cryo-em map of the focused refinement of the subfamily iii haloalkane dehalogenase from haloferax mediterranei dimer forming hexameric assembly. 0.8726 4 271
ID Description Score Start End Superfamily
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8687 1 272 3.40.50.1820
af_I1KVG4_94_375_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.868 7 270 3.40.50.1820
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8659 1 272 3.40.50.1820
4mebB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8593 5 272 3.40.50.1820
3kd2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8566 5 272 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A537X8J3-F1-model_v4 Alpha/beta hydrolase 0.979 2 270 GO:0016787
AF-A0A524JD78-F1-model_v4 Alpha/beta hydrolase 0.9763 2 271 GO:0016020
GO:0016787
AF-A0A7W0UUL2-F1-model_v4 Alpha/beta hydrolase 0.967 118 271 GO:0016787
AF-A0A524JD78-F1-model_v4 Alpha/beta hydrolase 0.9657 2 271 GO:0016020
GO:0016787
AF-A0A6I2Y8P2-F1-model_v4 Alpha/beta fold hydrolase 0.9652 1 271 GO:0016020
GO:0046464
GO:0047372

Map