F236248

General Info

Members Datasets Scaffolds Average Seq Length
161 138 322 96

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100120801|Ga0070668_1001208011
Length 98
Sequence MAEHRQVPEPGETIYAPRPSWGPVFFAIGALGLICGTFASGFIFAPKIWGLIGLIFLLAAFRSIVRGSVRDYYRLPRRQEVRGAALPVETISGPPRAQ

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 10.56
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100120801 3300005347 Bacteria 2094
2 LJNas_1026769 3300000546 Unclassified 617
3 JGI25406J46586_10070815 3300003203 Bacteria 1095
4 Ga0070683_100006417 3300005329 Bacteria 9863
5 Ga0070683_100009649 3300005329 Bacteria 8260
6 Ga0070670_100144916 3300005331 Bacteria 2055
7 Ga0070666_10030539 3300005335 Bacteria 3551
8 Ga0068868_100022371 3300005338 Bacteria 4770
9 Ga0070687_100085516 3300005343 Bacteria 1731
10 Ga0070661_100000004 3300005344 Bacteria 243876
11 Ga0070675_100000050 3300005354 Bacteria 72016
12 Ga0070671_100061637 3300005355 Bacteria 3124
13 Ga0070673_100572939 3300005364 Bacteria 1027
14 Ga0070688_100000010 3300005365 Bacteria 84103
15 Ga0070688_100000686 3300005365 Bacteria 16820
16 Ga0070713_100486707 3300005436 Bacteria 1163
17 Ga0070710_10154265 3300005437 Bacteria 1419
18 Ga0070711_100047966 3300005439 Bacteria 2918
19 Ga0070700_100714685 3300005441 Bacteria 798
20 Ga0070678_100007037 3300005456 Bacteria 6650
21 Ga0070685_10000010 3300005466 Bacteria 146946
22 Ga0070685_10001080 3300005466 Bacteria 14623
23 Ga0070684_100111225 3300005535 Bacteria 2456
24 Ga0070684_100204170 3300005535 Bacteria 1800
25 Ga0070684_100315429 3300005535 Bacteria 1436
26 Ga0070672_100000031 3300005543 Bacteria 62241
27 Ga0070686_100166436 3300005544 Bacteria 1556
28 Ga0070693_100725333 3300005547 Bacteria 730
29 Ga0070665_100002868 3300005548 Bacteria 18629
30 Ga0070665_100038076 3300005548 Bacteria 4835
31 Ga0070665_100467901 3300005548 Bacteria 1271
32 Ga0070665_101210830 3300005548 Unclassified 766
33 Ga0070665_101499073 3300005548 Bacteria 683
34 Ga0070704_100291644 3300005549 Bacteria 1356
35 Ga0070664_100052530 3300005564 Bacteria 3453
36 Ga0068857_101641337 3300005577 Bacteria 628
37 Ga0068852_100000994 3300005616 Bacteria 18720
38 Ga0068852_100063963 3300005616 Bacteria 3205
39 Ga0068851_10003112 3300005834 Bacteria 7354
40 Ga0068863_100121298 3300005841 Bacteria 2493
41 Ga0068862_101090938 3300005844 Bacteria 793
42 Ga0081539_10000776 3300005985 Bacteria 62705
43 Ga0070712_100000841 3300006175 Bacteria 18240
44 Ga0075430_100086767 3300006846 Bacteria 2619
45 Ga0068865_101561911 3300006881 Bacteria 592
46 Ga0105245_10000117 3300009098 Bacteria 76863
47 Ga0105247_10050849 3300009101 Bacteria 2551
48 Ga0105247_10078003 3300009101 Unclassified 2083
49 Ga0105243_10007042 3300009148 Bacteria 8652
50 Ga0105241_10116429 3300009174 Bacteria 2146
51 Ga0105249_11034453 3300009553 Bacteria 890
52 Ga0157371_10004888 3300013102 Bacteria 11513
53 Ga0157369_10001730 3300013105 Bacteria 26528
54 Ga0157378_10016178 3300013297 Bacteria 6532
55 Ga0157378_10149338 3300013297 Bacteria 2176
56 Ga0157375_10009414 3300013308 Bacteria 8576
57 Ga0157380_10000007 3300014326 Bacteria 157634
58 Ga0157379_10712100 3300014968 Bacteria 943
59 Ga0157376_10078125 3300014969 Bacteria 2833
60 Ga0207656_10017412 3300025321 Bacteria 2815
61 Ga0207692_10126787 3300025898 Bacteria 1437
62 Ga0207710_10041562 3300025900 Unclassified 2039
63 Ga0207680_10007123 3300025903 Bacteria 5437
64 Ga0207693_10010825 3300025915 Bacteria 7404
65 Ga0207662_10941107 3300025918 Bacteria 612
66 Ga0207649_10000003 3300025920 Bacteria 388908
67 Ga0207650_10030751 3300025925 Bacteria 3871
68 Ga0207659_10000055 3300025926 Bacteria 74252
69 Ga0207687_10000070 3300025927 Bacteria 77432
70 Ga0207700_10000003 3300025928 Bacteria 500797
71 Ga0207709_10003313 3300025935 Bacteria 9648
72 Ga0207704_10000104 3300025938 Bacteria 46614
73 Ga0207704_11253647 3300025938 Bacteria 633
74 Ga0207691_10000178 3300025940 Bacteria 60110
75 Ga0207711_10000011 3300025941 Bacteria 518817
76 Ga0207661_10002281 3300025944 Bacteria 13216
77 Ga0207661_10004619 3300025944 Bacteria 9651
78 Ga0207668_11093609 3300025972 Bacteria 714
79 Ga0207658_10056859 3300025986 Bacteria 2905
80 Ga0207677_10009001 3300026023 Bacteria 5602
81 Ga0207678_11697084 3300026067 Bacteria 555
82 Ga0207708_10524947 3300026075 Bacteria 995
83 Ga0207702_10000105 3300026078 Bacteria 97835
84 Ga0207641_10076027 3300026088 Bacteria 2902
85 Ga0207674_11043826 3300026116 Bacteria 786
86 Ga0207683_10167842 3300026121 Bacteria 1987
87 Ga0207698_10000015 3300026142 Bacteria 207368
88 Ga0207698_10044308 3300026142 Bacteria 3342
89 Ga0268266_10000526 3300028379 Bacteria 53404
90 Ga0268266_10015588 3300028379 Bacteria 6515
91 Ga0268266_10060957 3300028379 Bacteria 3253
92 Ga0268265_12430781 3300028380 Bacteria 530
93 Ga0265319_1000010 3300028563 Bacteria 188773
94 Ga0265322_10070946 3300028654 Bacteria 988
95 Ga0265336_10047644 3300028666 Bacteria 1301
96 Ga0265338_10000287 3300028800 Bacteria 90818
97 Ga0265324_10101630 3300029957 Bacteria 977
98 Ga0265325_10028601 3300031241 Bacteria 3003
99 Ga0265331_10370694 3300031250 Bacteria 642
100 Ga0265313_10124893 3300031595 Bacteria 1119
101 Ga0265342_10144521 3300031712 Bacteria 1325
102 Ga0307405_10978015 3300031731 Bacteria 721
103 Ga0307416_103064029 3300032002 Bacteria 559
104 Ga0307415_100649460 3300032126 Bacteria 945
105 Ga0316583_10248539 3300032133 Unclassified 616
106 Ga0451807_1783664 3300041486 Unclassified 504
107 Ga0451839_1033735 3300041496 Bacteria 627
108 Ga0451845_0036765 3300041501 Unclassified 695
109 Ga0451853_2804839 3300041512 Bacteria 2000
110 Ga0466957_0001268 3300044842 Bacteria 13149
111 Ga0466957_0441928 3300044842 Bacteria 895
112 Ga0466958_0025743 3300045836 Bacteria 3472
113 Ga0466967_0000002 3300045976 Bacteria 219994
114 Ga0495592_0444648 3300046454 Bacteria 813
115 Ga0495629_0000828 3300046459 Bacteria 25082
116 Ga0495638_0040838 3300046460 Bacteria 2938
117 Ga0495585_0600906 3300046492 Bacteria 517
118 Ga0495606_0000017 3300046507 Bacteria 284549
119 Ga0495608_0000013 3300046511 Bacteria 228481
120 Ga0495628_0003421 3300046516 Bacteria 14207
121 Ga0495630_0000032 3300046517 Bacteria 134425
122 Ga0495587_0405674 3300046536 Bacteria 757
123 Ga0495625_0000243 3300046660 Bacteria 85589
124 Ga0495588_0000073 3300046674 Bacteria 219005
125 Ga0495657_0000003 3300046675 Bacteria 279680
126 Ga0495647_0010829 3300046681 Bacteria 3114
127 Ga0495658_0016938 3300046683 Bacteria 3756
128 Ga0495613_0000027 3300046689 Bacteria 146674
129 Ga0495624_0000691 3300046690 Bacteria 26457
130 Ga0495604_0000723 3300047317 Bacteria 27948
131 Ga0495674_0000039 3300047319 Bacteria 97645
132 Ga0495676_0007903 3300047321 Bacteria 9752
133 Ga0495675_0000002 3300047444 Bacteria 216469
134 Ga0495593_0411574 3300047673 Unclassified 676
135 Ga0495602_0009482 3300048088 Bacteria 10121
136 Ga0495602_0156364 3300048088 Bacteria 1785
137 Ga0496100_0000001 3300048903 Bacteria 530179
138 Ga0496101_0000028 3300048904 Bacteria 198664
139 Ga0496102_0758629 3300048905 Bacteria 893
140 Ga0496104_0583396 3300048907 Unclassified 1028
141 Ga0496106_0000218 3300048909 Bacteria 40075
142 Ga0496107_0000002 3300048910 Bacteria 320871
143 Ga0496108_0000005 3300048911 Bacteria 535059
144 Ga0496108_0681115 3300048911 Bacteria 892
145 Ga0496109_0000002 3300048912 Bacteria 443393
146 Ga0496109_0000221 3300048912 Bacteria 56054
147 Ga0496110_0193784 3300048913 Bacteria 1845
148 Ga0496111_0005704 3300048914 Bacteria 8021
149 Ga0496111_0137654 3300048914 Bacteria 1809
150 Ga0496112_0021401 3300048915 Bacteria 6150
151 Ga0496113_0000005 3300048916 Bacteria 105956
152 Ga0496113_0594285 3300048916 Bacteria 886
153 Ga0496124_0371825 3300048927 Bacteria 1003
154 Ga0501042_0009362 3300049578 Bacteria 6526
155 Ga0501076_0016445 3300049592 Bacteria 5609
156 nmdc:mga0yw44_504095_c1 3300050492 Bacteria 821
157 nmdc:mga0qj67_308438_c1 3300050509 Bacteria 1282
158 Ga0495601_0000017 3300053077 Bacteria 204209
159 Ga0495612_0010356 3300053078 Bacteria 3772
160 Ga0495595_0000007 3300053084 Bacteria 228504
161 Ga0495619_0000026 3300053085 Bacteria 167387
162 Ga0070668_100120801
163 LJNas_1026769
164 JGI25406J46586_10070815
165 Ga0070683_100006417
166 Ga0070683_100009649
167 Ga0070670_100144916
168 Ga0070666_10030539
169 Ga0068868_100022371
170 Ga0070687_100085516
171 Ga0070661_100000004
172 Ga0070675_100000050
173 Ga0070671_100061637
174 Ga0070673_100572939
175 Ga0070688_100000010
176 Ga0070688_100000686
177 Ga0070713_100486707
178 Ga0070710_10154265
179 Ga0070711_100047966
180 Ga0070700_100714685
181 Ga0070678_100007037
182 Ga0070685_10000010
183 Ga0070685_10001080
184 Ga0070684_100111225
185 Ga0070684_100204170
186 Ga0070684_100315429
187 Ga0070672_100000031
188 Ga0070686_100166436
189 Ga0070693_100725333
190 Ga0070665_100002868
191 Ga0070665_100038076
192 Ga0070665_100467901
193 Ga0070665_101210830
194 Ga0070665_101499073
195 Ga0070704_100291644
196 Ga0070664_100052530
197 Ga0068857_101641337
198 Ga0068852_100000994
199 Ga0068852_100063963
200 Ga0068851_10003112
201 Ga0068863_100121298
202 Ga0068862_101090938
203 Ga0081539_10000776
204 Ga0070712_100000841
205 Ga0075430_100086767
206 Ga0068865_101561911
207 Ga0105245_10000117
208 Ga0105247_10050849
209 Ga0105247_10078003
210 Ga0105243_10007042
211 Ga0105241_10116429
212 Ga0105249_11034453
213 Ga0157371_10004888
214 Ga0157369_10001730
215 Ga0157378_10016178
216 Ga0157378_10149338
217 Ga0157375_10009414
218 Ga0157380_10000007
219 Ga0157379_10712100
220 Ga0157376_10078125
221 Ga0207656_10017412
222 Ga0207692_10126787
223 Ga0207710_10041562
224 Ga0207680_10007123
225 Ga0207693_10010825
226 Ga0207662_10941107
227 Ga0207649_10000003
228 Ga0207650_10030751
229 Ga0207659_10000055
230 Ga0207687_10000070
231 Ga0207700_10000003
232 Ga0207709_10003313
233 Ga0207704_10000104
234 Ga0207704_11253647
235 Ga0207691_10000178
236 Ga0207711_10000011
237 Ga0207661_10002281
238 Ga0207661_10004619
239 Ga0207668_11093609
240 Ga0207658_10056859
241 Ga0207677_10009001
242 Ga0207678_11697084
243 Ga0207708_10524947
244 Ga0207702_10000105
245 Ga0207641_10076027
246 Ga0207674_11043826
247 Ga0207683_10167842
248 Ga0207698_10000015
249 Ga0207698_10044308
250 Ga0268266_10000526
251 Ga0268266_10015588
252 Ga0268266_10060957
253 Ga0268265_12430781
254 Ga0265319_1000010
255 Ga0265322_10070946
256 Ga0265336_10047644
257 Ga0265338_10000287
258 Ga0265324_10101630
259 Ga0265325_10028601
260 Ga0265331_10370694
261 Ga0265313_10124893
262 Ga0265342_10144521
263 Ga0307405_10978015
264 Ga0307416_103064029
265 Ga0307415_100649460
266 Ga0316583_10248539
267 Ga0451807_1783664
268 Ga0451839_1033735
269 Ga0451845_0036765
270 Ga0451853_2804839
271 Ga0466957_0001268
272 Ga0466957_0441928
273 Ga0466958_0025743
274 Ga0466967_0000002
275 Ga0495592_0444648
276 Ga0495629_0000828
277 Ga0495638_0040838
278 Ga0495585_0600906
279 Ga0495606_0000017
280 Ga0495608_0000013
281 Ga0495628_0003421
282 Ga0495630_0000032
283 Ga0495587_0405674
284 Ga0495625_0000243
285 Ga0495588_0000073
286 Ga0495657_0000003
287 Ga0495647_0010829
288 Ga0495658_0016938
289 Ga0495613_0000027
290 Ga0495624_0000691
291 Ga0495604_0000723
292 Ga0495674_0000039
293 Ga0495676_0007903
294 Ga0495675_0000002
295 Ga0495593_0411574
296 Ga0495602_0009482
297 Ga0495602_0156364
298 Ga0496100_0000001
299 Ga0496101_0000028
300 Ga0496102_0758629
301 Ga0496104_0583396
302 Ga0496106_0000218
303 Ga0496107_0000002
304 Ga0496108_0000005
305 Ga0496108_0681115
306 Ga0496109_0000002
307 Ga0496109_0000221
308 Ga0496110_0193784
309 Ga0496111_0005704
310 Ga0496111_0137654
311 Ga0496112_0021401
312 Ga0496113_0000005
313 Ga0496113_0594285
314 Ga0496124_0371825
315 Ga0501042_0009362
316 Ga0501076_0016445
317 nmdc:mga0yw44_504095_c1
318 nmdc:mga0qj67_308438_c1
319 Ga0495601_0000017
320 Ga0495612_0010356
321 Ga0495595_0000007
322 Ga0495619_0000026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.8285 22 73
1g4y-assembly1.cif.gz_B-2 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin 0.7768 22 73
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.776 15 70
5v03-assembly1.cif.gz_B a positive allosteric modulator binding pocket in sk2 ion channels is shared by riluzole and cyppa 0.7748 22 73
8h3f-assembly1.cif.gz_E cryo-em structure of the kbtbd2-crl3-csn complex 0.7724 22 75
ID Description Score Start End Superfamily
af_A0A0N7KNF8_52_165_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8308 22 73 1.20.58.390
af_Q08BZ6_1_87_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7945 22 74 1.20.58.80
3iqfL02 Special;Helix non-globular;Helix Hairpins; 0.7942 22 74 6.10.140.120
1u6iA02 Special;Helix non-globular;Helix Hairpins; 0.7939 22 74 6.10.140.120
3iqfC02 Special;Helix non-globular;Helix Hairpins; 0.7928 22 74 6.10.140.120
ID Description Score Start End GO Terms
AF-A0A7D5JC87-F1-model_v4 Uncharacterized protein 0.8004 22 83 GO:0016020
AF-A0A1Q3NCN6-F1-model_v4 deleted 0.7905 5 96
AF-Q5VB06-F1-model_v4 Cytochrome c oxidase subunit 3 0.7689 15 80 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A1Q3NCN6-F1-model_v4 deleted 0.7686 5 96
AF-A0A7Z0CZ99-F1-model_v4 deleted 0.7569 22 78

Map