F237169

General Info

Members Datasets Scaffolds Average Seq Length
161 129 322 184

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10175782|Ga0207665_101757822
Length 206
Sequence MSAEKPTDDKPALPVSVAVEKIDSLSASDLADLCEATEAAVEEGGGFGWVKRPQRETLEKYWRGFLLVPGRALFVARLDGVIAGSAQLIRPPRNNEAQAFSAQLTSTFVAPWARGHGLARGLLAAVEHSARRAGVAILNLDVRDTQQAAIRLYESAGYTRWGTHPAYARVAGKIVPGHFYFKRLTPEEPGGGSDAGPELDPGRDRA

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
68 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
111 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
118 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
119 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
120 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
121 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
122 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
123 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
124 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
125 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
126 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
127 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
128 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
129 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0.62
Isolates 8.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.07
Nodule 0.62
Rhizoplane 3.73
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10175782 3300025939 Bacteria 1548
2 JGI25151J46595_10000240 3300003187 Bacteria 64258
3 Ga0070680_100003831 3300005336 Bacteria 11249
4 Ga0070680_100117109 3300005336 Bacteria 2221
5 Ga0070659_100132388 3300005366 Bacteria 2026
6 Ga0070708_100571348 3300005445 Bacteria 1066
7 Ga0070681_10000290 3300005458 Bacteria 40569
8 Ga0070681_10236528 3300005458 Bacteria 1740
9 Ga0070679_100006551 3300005530 Bacteria 10853
10 Ga0070679_100106712 3300005530 Bacteria 2786
11 Ga0070679_100717240 3300005530 Bacteria 943
12 Ga0068853_100051936 3300005539 Bacteria 3530
13 Ga0070686_100548721 3300005544 Bacteria 904
14 Ga0070695_100131053 3300005545 Bacteria 1728
15 Ga0070696_100208175 3300005546 Bacteria 1463
16 Ga0070696_100436410 3300005546 Bacteria 1031
17 Ga0068854_100360857 3300005578 Bacteria 1192
18 Ga0068859_100431424 3300005617 Bacteria 1414
19 Ga0068864_100749217 3300005618 Bacteria 957
20 Ga0081540_1045900 3300005983 Bacteria 2212
21 Ga0070712_100433140 3300006175 Bacteria 1092
22 Ga0075430_100171927 3300006846 Bacteria 1803
23 Ga0075433_10225900 3300006852 Bacteria 1663
24 Ga0075434_100396206 3300006871 Bacteria 1402
25 Ga0097620_100431434 3300006931 Bacteria 1414
26 Ga0105240_10033685 3300009093 Bacteria 6615
27 Ga0114129_10341683 3300009147 Bacteria 1985
28 Ga0105241_10567545 3300009174 Bacteria 1021
29 Ga0105249_10481787 3300009553 Bacteria 1284
30 Ga0157370_10002708 3300013104 Bacteria 21192
31 Ga0157370_10101790 3300013104 Bacteria 2690
32 Ga0182008_10293115 3300014497 Bacteria 849
33 Ga0182008_10306927 3300014497 Bacteria 832
34 Ga0206356_10337032 3300020070 Bacteria 1020
35 Ga0209130_1000282 3300025284 Bacteria 62561
36 Ga0209675_1004204 3300025291 Bacteria 6504
37 Ga0209675_1032325 3300025291 Bacteria 1226
38 Ga0209025_1000179 3300025294 Bacteria 157965
39 Ga0209564_1037326 3300025295 Bacteria 1371
40 Ga0209758_1002547 3300025297 Bacteria 18378
41 Ga0207426_1000191 3300025302 Bacteria 151850
42 Ga0207707_10005011 3300025912 Bacteria 11631
43 Ga0207707_10121246 3300025912 Bacteria 2286
44 Ga0207707_10850054 3300025912 Bacteria 757
45 Ga0207695_10234964 3300025913 Bacteria 1736
46 Ga0207693_10107031 3300025915 Bacteria 2193
47 Ga0207660_10086158 3300025917 Bacteria 2319
48 Ga0207652_10198360 3300025921 Bacteria 1806
49 Ga0207652_10380928 3300025921 Bacteria 1273
50 Ga0207661_10149981 3300025944 Bacteria 2015
51 Ga0207703_10555424 3300026035 Bacteria 1083
52 Ga0207639_10033961 3300026041 Bacteria 3767
53 Ga0307515_10131748 3300028794 Bacteria 2748
54 Ga0265316_10018469 3300031344 Bacteria 5991
55 Ga0307408_100848004 3300031548 Bacteria 833
56 Ga0265313_10047233 3300031595 Bacteria 2085
57 Ga0307405_10676670 3300031731 Bacteria 852
58 Ga0307406_10062805 3300031901 Bacteria 2404
59 Ga0307407_10043185 3300031903 Bacteria 2533
60 Ga0307409_101353056 3300031995 Bacteria 738
61 Ga0307416_100114817 3300032002 Bacteria 2383
62 Ga0307414_10096207 3300032004 Bacteria 2215
63 Ga0307414_10561935 3300032004 Bacteria 1018
64 Ga0373956_0050227 3300035119 Bacteria 1872
65 Ga0373943_0174163 3300035170 Bacteria 1179
66 Ga0373931_0623152 3300035691 Unclassified 707
67 Ga0373947_0078688 3300035725 Bacteria 2036
68 Ga0373947_0290692 3300035725 Bacteria 1088
69 Ga0373937_0029452 3300036401 Bacteria 4972
70 Ga0395900_0202579 3300037418 Bacteria 2007
71 Ga0395905_0203317 3300037471 Bacteria 1857
72 Ga0395905_0299911 3300037471 Bacteria 1494
73 Ga0395905_0301505 3300037471 Bacteria 1490
74 Ga0395901_0000384 3300038443 Bacteria 52947
75 Ga0395901_0335736 3300038443 Bacteria 1562
76 Ga0436365_1414992 3300039437 Bacteria 1663
77 Ga0436360_0199305 3300039438 Bacteria 1305
78 Ga0436361_0117502 3300039447 Bacteria 1996
79 Ga0436361_0853495 3300039447 Bacteria 6292
80 Ga0436363_1338364 3300039450 Bacteria 873
81 Ga0436362_0873228 3300039453 Bacteria 1280
82 Ga0439447_036302 3300041407 Bacteria 1218
83 Ga0439465_0127942 3300041413 Bacteria 895
84 Ga0450920_053297 3300042122 Bacteria 813
85 Ga0450907_025709 3300042146 Bacteria 996
86 Ga0453684_0419357 3300044712 Bacteria 1495
87 Ga0466967_0360749 3300045976 Bacteria 1408
88 Ga0495592_0086884 3300046454 Bacteria 2251
89 Ga0495639_0298559 3300046475 Bacteria 803
90 Ga0495610_0027427 3300046512 Bacteria 3026
91 Ga0495610_0042099 3300046512 Bacteria 2287
92 Ga0495628_0156556 3300046516 Bacteria 1733
93 Ga0495586_0015004 3300046535 Bacteria 4118
94 Ga0495667_0020624 3300046559 Bacteria 4446
95 Ga0495635_0031844 3300046663 Bacteria 3659
96 Ga0495649_0068110 3300046694 Bacteria 1910
97 Ga0495680_0103794 3300047322 Bacteria 2115
98 Ga0495684_0468764 3300047471 Bacteria 872
99 Ga0496102_0116510 3300048905 Bacteria 2493
100 Ga0496103_0275153 3300048906 Bacteria 1083
101 Ga0496110_0291881 3300048913 Bacteria 1485
102 Ga0496111_0257419 3300048914 Bacteria 1295
103 Ga0496112_0153016 3300048915 Bacteria 2274
104 Ga0496113_0119763 3300048916 Bacteria 2057
105 Ga0501034_0000001 3300049571 Bacteria 2184493
106 Ga0501034_0133821 3300049571 Bacteria 2461
107 Ga0501034_0627348 3300049571 Bacteria 978
108 Ga0501034_0660178 3300049571 Bacteria 947
109 Ga0501036_0010669 3300049572 Bacteria 7593
110 Ga0501037_0006269 3300049573 Bacteria 8696
111 Ga0501037_0637275 3300049573 Unclassified 713
112 Ga0501039_0000001 3300049575 Bacteria 449008
113 Ga0501048_0551780 3300049582 Bacteria 827
114 Ga0501067_0407573 3300049583 Bacteria 758
115 Ga0501069_0230754 3300049585 Bacteria 1077
116 Ga0501070_0220809 3300049586 Bacteria 1554
117 Ga0501070_0642201 3300049586 Bacteria 843
118 Ga0501072_0202716 3300049588 Bacteria 1582
119 Ga0501073_0052785 3300049589 Bacteria 2846
120 Ga0501073_0076332 3300049589 Bacteria 2332
121 Ga0501075_0421990 3300049591 Bacteria 1017
122 Ga0501076_0654576 3300049592 Bacteria 867
123 Ga0501080_0114963 3300049742 Bacteria 2495
124 Ga0501080_0588343 3300049742 Bacteria 989
125 Ga0501081_0605448 3300049743 Bacteria 820
126 Ga0501083_0024164 3300049744 Bacteria 4213
127 Ga0501083_0039769 3300049744 Bacteria 3194
128 Ga0501035_0051053 3300049822 Bacteria 3704
129 Ga0501035_0157314 3300049822 Unclassified 1969
130 Ga0501035_0383637 3300049822 Bacteria 1172
131 Ga0501044_0040362 3300049823 Bacteria 4864
132 Ga0501044_0116188 3300049823 Bacteria 2681
133 nmdc:mga05p37_1134553_c1 3300050507 Bacteria 815
134 nmdc:mga06r32_399023_c1 3300050510 Bacteria 1357
135 nmdc:mga0n895_1095293_c1 3300050512 Bacteria 774
136 nmdc:mga0n895_211124_c1 3300050512 Bacteria 1971
137 nmdc:mga0a205_371871_c1 3300050515 Bacteria 1295
138 Ga0495601_0000984 3300053077 Bacteria 15569
139 Ga0495619_0014962 3300053085 Bacteria 4901
140 Ga0500644_0053468 3300053088 Bacteria 1394
141 Ga0500595_011768 3300053119 Bacteria 3408
142 Ga0500568_0057395 3300053139 Bacteria 1515
143 Ga0500616_0108007 3300053153 Bacteria 1349
144 Ga0500636_0011171 3300053177 Bacteria 5254
145 Ga0501084_0522066 3300054114 Bacteria 1004
146 Ga0501082_0106297 3300060353 Bacteria 2428
147 Ga0501082_0127708 3300060353 Bacteria 2205
148 Ga0501082_0499567 3300060353 Bacteria 1063
149 2512034784 2511231221 Bacteria 6846400
150 2523103421 2522572158 Bacteria 6514390
151 2524611391 2524023250 Bacteria 5457705
152 2599102804 2597490356 Bacteria 7030811
153 2821450261 2821443989 Bacteria 7658172
154 2842335340 2842333319 Bacteria 8899485
155 2844538789 2844533157 Bacteria 7517899
156 2846952678 2846952575 Bacteria 6587527
157 2848861167 2848858292 Bacteria 7391279
158 2883297097 2883291878 Bacteria 5894118
159 2883359877 2883354860 Bacteria 5865246
160 2897808732 2897803580 Bacteria 7000062
161 8054003772 8054002106 Bacteria 7987183
162 Ga0207665_10175782
163 JGI25151J46595_10000240
164 Ga0070680_100003831
165 Ga0070680_100117109
166 Ga0070659_100132388
167 Ga0070708_100571348
168 Ga0070681_10000290
169 Ga0070681_10236528
170 Ga0070679_100006551
171 Ga0070679_100106712
172 Ga0070679_100717240
173 Ga0068853_100051936
174 Ga0070686_100548721
175 Ga0070695_100131053
176 Ga0070696_100208175
177 Ga0070696_100436410
178 Ga0068854_100360857
179 Ga0068859_100431424
180 Ga0068864_100749217
181 Ga0081540_1045900
182 Ga0070712_100433140
183 Ga0075430_100171927
184 Ga0075433_10225900
185 Ga0075434_100396206
186 Ga0097620_100431434
187 Ga0105240_10033685
188 Ga0114129_10341683
189 Ga0105241_10567545
190 Ga0105249_10481787
191 Ga0157370_10002708
192 Ga0157370_10101790
193 Ga0182008_10293115
194 Ga0182008_10306927
195 Ga0206356_10337032
196 Ga0209130_1000282
197 Ga0209675_1004204
198 Ga0209675_1032325
199 Ga0209025_1000179
200 Ga0209564_1037326
201 Ga0209758_1002547
202 Ga0207426_1000191
203 Ga0207707_10005011
204 Ga0207707_10121246
205 Ga0207707_10850054
206 Ga0207695_10234964
207 Ga0207693_10107031
208 Ga0207660_10086158
209 Ga0207652_10198360
210 Ga0207652_10380928
211 Ga0207661_10149981
212 Ga0207703_10555424
213 Ga0207639_10033961
214 Ga0307515_10131748
215 Ga0265316_10018469
216 Ga0307408_100848004
217 Ga0265313_10047233
218 Ga0307405_10676670
219 Ga0307406_10062805
220 Ga0307407_10043185
221 Ga0307409_101353056
222 Ga0307416_100114817
223 Ga0307414_10096207
224 Ga0307414_10561935
225 Ga0373956_0050227
226 Ga0373943_0174163
227 Ga0373931_0623152
228 Ga0373947_0078688
229 Ga0373947_0290692
230 Ga0373937_0029452
231 Ga0395900_0202579
232 Ga0395905_0203317
233 Ga0395905_0299911
234 Ga0395905_0301505
235 Ga0395901_0000384
236 Ga0395901_0335736
237 Ga0436365_1414992
238 Ga0436360_0199305
239 Ga0436361_0117502
240 Ga0436361_0853495
241 Ga0436363_1338364
242 Ga0436362_0873228
243 Ga0439447_036302
244 Ga0439465_0127942
245 Ga0450920_053297
246 Ga0450907_025709
247 Ga0453684_0419357
248 Ga0466967_0360749
249 Ga0495592_0086884
250 Ga0495639_0298559
251 Ga0495610_0027427
252 Ga0495610_0042099
253 Ga0495628_0156556
254 Ga0495586_0015004
255 Ga0495667_0020624
256 Ga0495635_0031844
257 Ga0495649_0068110
258 Ga0495680_0103794
259 Ga0495684_0468764
260 Ga0496102_0116510
261 Ga0496103_0275153
262 Ga0496110_0291881
263 Ga0496111_0257419
264 Ga0496112_0153016
265 Ga0496113_0119763
266 Ga0501034_0000001
267 Ga0501034_0133821
268 Ga0501034_0627348
269 Ga0501034_0660178
270 Ga0501036_0010669
271 Ga0501037_0006269
272 Ga0501037_0637275
273 Ga0501039_0000001
274 Ga0501048_0551780
275 Ga0501067_0407573
276 Ga0501069_0230754
277 Ga0501070_0220809
278 Ga0501070_0642201
279 Ga0501072_0202716
280 Ga0501073_0052785
281 Ga0501073_0076332
282 Ga0501075_0421990
283 Ga0501076_0654576
284 Ga0501080_0114963
285 Ga0501080_0588343
286 Ga0501081_0605448
287 Ga0501083_0024164
288 Ga0501083_0039769
289 Ga0501035_0051053
290 Ga0501035_0157314
291 Ga0501035_0383637
292 Ga0501044_0040362
293 Ga0501044_0116188
294 nmdc:mga05p37_1134553_c1
295 nmdc:mga06r32_399023_c1
296 nmdc:mga0n895_1095293_c1
297 nmdc:mga0n895_211124_c1
298 nmdc:mga0a205_371871_c1
299 Ga0495601_0000984
300 Ga0495619_0014962
301 Ga0500644_0053468
302 Ga0500595_011768
303 Ga0500568_0057395
304 Ga0500616_0108007
305 Ga0500636_0011171
306 Ga0501084_0522066
307 Ga0501082_0106297
308 Ga0501082_0127708
309 Ga0501082_0499567
310 2512034784
311 2523103421
312 2524611391
313 2599102804
314 2821450261
315 2842335340
316 2844538789
317 2846952678
318 2848861167
319 2883297097
320 2883359877
321 2897808732
322 8054003772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

34

158

0.87

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

48

168

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

69

160

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.8569 12 167
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.7877 12 167
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.7862 12 167
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.7855 10 167
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.7843 10 163
ID Description Score Start End Superfamily
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8924 19 165 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.877 97 163 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8487 121 163 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8355 16 165 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8302 12 167 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2E3XE09-F1-model_v4 GNAT family N-acetyltransferase 0.9697 8 167 GO:0016747
AF-A0A537UZ86-F1-model_v4 GNAT family N-acetyltransferase 0.969 18 165 GO:0016747
AF-A0A2E1TSQ6-F1-model_v4 GNAT family N-acetyltransferase 0.9683 12 165 GO:0016747
AF-A0A4R6WSY6-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9642 5 168 GO:0005840
GO:0016747
AF-A0A7C7N1Q4-F1-model_v4 deleted 0.9639 8 168

Map