F237261

General Info

Members Datasets Scaffolds Average Seq Length
161 103 322 365

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10015235|Ga0265338_100152352
Length 381
Sequence MQFTPGAAGPTVPAMTIGLPKEIKPQEHRVALVPSAAYQLIKHGHRVLVERGAGAGSGYPDADYEAAGASLVDSHAGVFAEAGLVVKVKEPLPEEYPLLRPGQILFTYLHLAADRRLTEALMKTGVTGIAYETIEVNRRLPLLEPMSEIAGRMSILVGGYFLAKHHGGSGTLLGGVPGVLPGKVVVLGGGVAGINAARMAIGLGADVTILEVDLERMRFLDITLHTSHTLYSSEAHLLDLLPSVDLLIGAVLVPGAKAPRLIRRDMLRRMRPGSVLVDIAIDQGGCAETSHPTTHNDPVFVEEGVTHYCVANMPGAYARTATQALTNVTHRYIELLADHGLAEACRIQPALAGGINIQNGQITCQAVADAHGVAFTPPQLG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
69 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
100 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.11
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10015235 3300028800 Bacteria 8469
2 rootH2_10040805 3300003320 Bacteria 5801
3 rootH2_10050510 3300003320 Bacteria 6718
4 rootL2_10122038 3300003322 Bacteria 9198
5 Ga0065715_10000368 3300005293 Bacteria 15488
6 Ga0070689_100004031 3300005340 Bacteria 9882
7 Ga0070668_100000055 3300005347 Bacteria 70835
8 Ga0070671_100005756 3300005355 Bacteria 9873
9 Ga0070714_100001583 3300005435 Bacteria 16542
10 Ga0070665_100108300 3300005548 Bacteria 2781
11 Ga0070665_100226029 3300005548 Bacteria 1872
12 Ga0068855_100001921 3300005563 Bacteria 25785
13 Ga0068856_100068724 3300005614 Bacteria 3502
14 Ga0068859_100134933 3300005617 Bacteria 2540
15 Ga0068859_100144857 3300005617 Bacteria 2450
16 Ga0068863_100000030 3300005841 Bacteria 176023
17 Ga0068863_100032422 3300005841 Bacteria 4980
18 Ga0068863_100331205 3300005841 Bacteria 1480
19 Ga0068858_100047507 3300005842 Bacteria 3979
20 Ga0068862_100059076 3300005844 Bacteria 3291
21 Ga0081455_10000027 3300005937 Bacteria 156832
22 Ga0081538_10022690 3300005981 Bacteria 4540
23 Ga0070712_100106961 3300006175 Bacteria 2080
24 Ga0075431_100021905 3300006847 Bacteria 6533
25 Ga0097620_100134928 3300006931 Bacteria 2540
26 Ga0097620_100144852 3300006931 Bacteria 2450
27 Ga0105240_10000508 3300009093 Bacteria 71878
28 Ga0105240_10003977 3300009093 Bacteria 22806
29 Ga0105240_10005677 3300009093 Bacteria 18522
30 Ga0105240_10054894 3300009093 Bacteria 4990
31 Ga0105240_10064074 3300009093 Bacteria 4569
32 Ga0111539_10177688 3300009094 Bacteria 2487
33 Ga0111539_10398027 3300009094 Bacteria 1604
34 Ga0111539_10453904 3300009094 Bacteria 1493
35 Ga0105245_10204049 3300009098 Bacteria 1900
36 Ga0105242_10212792 3300009176 Bacteria 1724
37 Ga0105238_10013396 3300009551 Bacteria 8278
38 Ga0105249_10138093 3300009553 Bacteria 2335
39 Ga0157374_10000026 3300013296 Bacteria 238236
40 Ga0157375_10000070 3300013308 Bacteria 108417
41 Ga0163163_10059423 3300014325 Bacteria 3782
42 Ga0157376_10003838 3300014969 Bacteria 10390
43 Ga0157376_10052531 3300014969 Bacteria 3389
44 Ga0213872_10004260 3300021361 Bacteria 7664
45 Ga0213872_10063852 3300021361 Bacteria 1664
46 Ga0209050_1000999 3300025298 Bacteria 35524
47 Ga0207699_10106352 3300025906 Bacteria 1791
48 Ga0207695_10001082 3300025913 Bacteria 47597
49 Ga0207695_10020213 3300025913 Bacteria 7633
50 Ga0207695_10024878 3300025913 Bacteria 6720
51 Ga0207695_10114295 3300025913 Bacteria 2675
52 Ga0207695_10175976 3300025913 Bacteria 2062
53 Ga0207694_10160839 3300025924 Bacteria 1814
54 Ga0207644_10000186 3300025931 Bacteria 44897
55 Ga0207670_10014324 3300025936 Bacteria 4705
56 Ga0207667_10003590 3300025949 Bacteria 19165
57 Ga0207712_10091875 3300025961 Bacteria 2236
58 Ga0207668_10000095 3300025972 Bacteria 63349
59 Ga0207703_10020599 3300026035 Bacteria 5159
60 Ga0207641_10000001 3300026088 Bacteria 1180841
61 Ga0207641_10064959 3300026088 Bacteria 3120
62 Ga0207641_10090002 3300026088 Bacteria 2683
63 Ga0207641_10295664 3300026088 Bacteria 1528
64 Ga0207648_10274402 3300026089 Bacteria 1507
65 Ga0268264_10015655 3300028381 Bacteria 6210
66 Ga0265334_10004401 3300028573 Bacteria 6255
67 Ga0265323_10000092 3300028653 Bacteria 51020
68 Ga0265323_10012791 3300028653 Bacteria 3358
69 Ga0265323_10020277 3300028653 Bacteria 2561
70 Ga0265322_10001975 3300028654 Bacteria 6468
71 Ga0265322_10006922 3300028654 Bacteria 3322
72 Ga0265338_10104688 3300028800 Bacteria 2295
73 Ga0307511_10006584 3300030521 Bacteria 11703
74 Ga0265330_10042041 3300031235 Bacteria 2026
75 Ga0265329_10001167 3300031242 Bacteria 12920
76 Ga0265329_10017891 3300031242 Bacteria 2432
77 Ga0265339_10095153 3300031249 Bacteria 1556
78 Ga0265316_10019412 3300031344 Bacteria 5816
79 Ga0265316_10058814 3300031344 Bacteria 2992
80 Ga0265316_10086674 3300031344 Bacteria 2393
81 Ga0265316_10174270 3300031344 Bacteria 1604
82 Ga0265314_10000115 3300031711 Bacteria 124024
83 Ga0265314_10100006 3300031711 Bacteria 1866
84 Ga0265342_10035808 3300031712 Bacteria 3034
85 Ga0265342_10070934 3300031712 Bacteria 2031
86 Ga0316593_10009964 3300032168 Bacteria 2707
87 Ga0373954_0013681 3300035118 Bacteria 3615
88 Ga0316574_0035765 3300035398 Bacteria 3037
89 Ga0373931_0099323 3300035691 Bacteria 1635
90 Ga0373927_0026033 3300035695 Bacteria 3824
91 Ga0373927_0027308 3300035695 Bacteria 3727
92 Ga0373947_0037004 3300035725 Bacteria 2895
93 Ga0373925_0002091 3300037068 Bacteria 16400
94 Ga0395905_0192408 3300037471 Bacteria 1913
95 Ga0395905_0255431 3300037471 Bacteria 1637
96 Ga0400483_023782 3300039062 Bacteria 5005
97 Ga0400483_202923 3300039062 Bacteria 4942
98 Ga0436365_1435552 3300039437 Bacteria 3785
99 Ga0436361_0195038 3300039447 Bacteria 8948
100 Ga0436361_0230187 3300039447 Bacteria 8214
101 Ga0436361_1031389 3300039447 Bacteria 10909
102 Ga0436363_0568219 3300039450 Bacteria 10993
103 Ga0436362_0201301 3300039453 Unclassified 2026
104 Ga0451795_0664674 3300041456 Bacteria 6271
105 Ga0439460_0025175 3300042461 Bacteria 1655
106 Ga0451577_0000744 3300042876 Bacteria 50061
107 Ga0451577_0036929 3300042876 Bacteria 4399
108 Ga0451577_0040635 3300042876 Bacteria 4175
109 Ga0451577_0045089 3300042876 Bacteria 3947
110 Ga0451577_0096387 3300042876 Bacteria 2641
111 Ga0466972_0099196 3300044658 Bacteria 1379
112 Ga0453683_0000002 3300044673 Bacteria 1244396
113 Ga0453683_0000131 3300044673 Bacteria 109628
114 Ga0453684_0050876 3300044712 Bacteria 5441
115 Ga0453684_0170901 3300044712 Bacteria 2562
116 Ga0453684_0326297 3300044712 Bacteria 1737
117 Ga0451576_0019927 3300045051 Bacteria 7311
118 Ga0451576_0058795 3300045051 Unclassified 4015
119 Ga0451576_0147137 3300045051 Bacteria 2456
120 Ga0451576_0188449 3300045051 Bacteria 2154
121 Ga0451576_0265608 3300045051 Bacteria 1794
122 Ga0451576_0283028 3300045051 Bacteria 1734
123 Ga0451576_0545519 3300045051 Bacteria 1218
124 Ga0495592_0000386 3300046454 Bacteria 34513
125 Ga0495662_0021040 3300046476 Bacteria 3155
126 Ga0495664_0016040 3300046477 Bacteria 4266
127 Ga0495618_0022384 3300046514 Bacteria 3903
128 Ga0495628_0000208 3300046516 Bacteria 51288
129 Ga0495628_0175931 3300046516 Bacteria 1621
130 Ga0495630_0000031 3300046517 Bacteria 135085
131 Ga0495630_0028955 3300046517 Bacteria 4116
132 Ga0495666_0004319 3300046526 Bacteria 7175
133 Ga0495666_0054024 3300046526 Bacteria 1927
134 Ga0495640_0070398 3300046533 Bacteria 2350
135 Ga0495586_0000016 3300046535 Bacteria 126380
136 Ga0495586_0000681 3300046535 Bacteria 19369
137 Ga0495645_0003416 3300046543 Bacteria 10764
138 Ga0495645_0065068 3300046543 Bacteria 2638
139 Ga0495668_0033049 3300046616 Bacteria 2908
140 Ga0495634_0053407 3300046642 Bacteria 2707
141 Ga0495634_0072833 3300046642 Bacteria 2259
142 Ga0495635_0076369 3300046663 Bacteria 2296
143 Ga0495599_0006549 3300046678 Bacteria 7029
144 Ga0495658_0068915 3300046683 Unclassified 2049
145 Ga0495669_0159236 3300046684 Bacteria 1071
146 Ga0495613_0052816 3300046689 Bacteria 2992
147 Ga0495674_0007026 3300047319 Bacteria 10771
148 Ga0495674_0007679 3300047319 Bacteria 10302
149 Ga0495676_0002290 3300047321 Bacteria 16987
150 Ga0495675_0106727 3300047444 Bacteria 1750
151 Ga0495684_0047774 3300047471 Bacteria 3273
152 Ga0495684_0312350 3300047471 Bacteria 1126
153 Ga0496102_0123201 3300048905 Bacteria 2422
154 Ga0496110_0140839 3300048913 Bacteria 2180
155 Ga0496110_0409938 3300048913 Bacteria 1235
156 Ga0496115_0002091 3300048918 Bacteria 14303
157 Ga0501223_017187 3300049663 Bacteria 1428
158 Ga0501257_000138 3300049686 Bacteria 16649
159 Ga0501083_0001577 3300049744 Bacteria 15575
160 Ga0501280_010730 3300049776 Bacteria 1277
161 Ga0500568_0021054 3300053139 Bacteria 2812
162 Ga0265338_10015235
163 rootH2_10040805
164 rootH2_10050510
165 rootL2_10122038
166 Ga0065715_10000368
167 Ga0070689_100004031
168 Ga0070668_100000055
169 Ga0070671_100005756
170 Ga0070714_100001583
171 Ga0070665_100108300
172 Ga0070665_100226029
173 Ga0068855_100001921
174 Ga0068856_100068724
175 Ga0068859_100134933
176 Ga0068859_100144857
177 Ga0068863_100000030
178 Ga0068863_100032422
179 Ga0068863_100331205
180 Ga0068858_100047507
181 Ga0068862_100059076
182 Ga0081455_10000027
183 Ga0081538_10022690
184 Ga0070712_100106961
185 Ga0075431_100021905
186 Ga0097620_100134928
187 Ga0097620_100144852
188 Ga0105240_10000508
189 Ga0105240_10003977
190 Ga0105240_10005677
191 Ga0105240_10054894
192 Ga0105240_10064074
193 Ga0111539_10177688
194 Ga0111539_10398027
195 Ga0111539_10453904
196 Ga0105245_10204049
197 Ga0105242_10212792
198 Ga0105238_10013396
199 Ga0105249_10138093
200 Ga0157374_10000026
201 Ga0157375_10000070
202 Ga0163163_10059423
203 Ga0157376_10003838
204 Ga0157376_10052531
205 Ga0213872_10004260
206 Ga0213872_10063852
207 Ga0209050_1000999
208 Ga0207699_10106352
209 Ga0207695_10001082
210 Ga0207695_10020213
211 Ga0207695_10024878
212 Ga0207695_10114295
213 Ga0207695_10175976
214 Ga0207694_10160839
215 Ga0207644_10000186
216 Ga0207670_10014324
217 Ga0207667_10003590
218 Ga0207712_10091875
219 Ga0207668_10000095
220 Ga0207703_10020599
221 Ga0207641_10000001
222 Ga0207641_10064959
223 Ga0207641_10090002
224 Ga0207641_10295664
225 Ga0207648_10274402
226 Ga0268264_10015655
227 Ga0265334_10004401
228 Ga0265323_10000092
229 Ga0265323_10012791
230 Ga0265323_10020277
231 Ga0265322_10001975
232 Ga0265322_10006922
233 Ga0265338_10104688
234 Ga0307511_10006584
235 Ga0265330_10042041
236 Ga0265329_10001167
237 Ga0265329_10017891
238 Ga0265339_10095153
239 Ga0265316_10019412
240 Ga0265316_10058814
241 Ga0265316_10086674
242 Ga0265316_10174270
243 Ga0265314_10000115
244 Ga0265314_10100006
245 Ga0265342_10035808
246 Ga0265342_10070934
247 Ga0316593_10009964
248 Ga0373954_0013681
249 Ga0316574_0035765
250 Ga0373931_0099323
251 Ga0373927_0026033
252 Ga0373927_0027308
253 Ga0373947_0037004
254 Ga0373925_0002091
255 Ga0395905_0192408
256 Ga0395905_0255431
257 Ga0400483_023782
258 Ga0400483_202923
259 Ga0436365_1435552
260 Ga0436361_0195038
261 Ga0436361_0230187
262 Ga0436361_1031389
263 Ga0436363_0568219
264 Ga0436362_0201301
265 Ga0451795_0664674
266 Ga0439460_0025175
267 Ga0451577_0000744
268 Ga0451577_0036929
269 Ga0451577_0040635
270 Ga0451577_0045089
271 Ga0451577_0096387
272 Ga0466972_0099196
273 Ga0453683_0000002
274 Ga0453683_0000131
275 Ga0453684_0050876
276 Ga0453684_0170901
277 Ga0453684_0326297
278 Ga0451576_0019927
279 Ga0451576_0058795
280 Ga0451576_0147137
281 Ga0451576_0188449
282 Ga0451576_0265608
283 Ga0451576_0283028
284 Ga0451576_0545519
285 Ga0495592_0000386
286 Ga0495662_0021040
287 Ga0495664_0016040
288 Ga0495618_0022384
289 Ga0495628_0000208
290 Ga0495628_0175931
291 Ga0495630_0000031
292 Ga0495630_0028955
293 Ga0495666_0004319
294 Ga0495666_0054024
295 Ga0495640_0070398
296 Ga0495586_0000016
297 Ga0495586_0000681
298 Ga0495645_0003416
299 Ga0495645_0065068
300 Ga0495668_0033049
301 Ga0495634_0053407
302 Ga0495634_0072833
303 Ga0495635_0076369
304 Ga0495599_0006549
305 Ga0495658_0068915
306 Ga0495669_0159236
307 Ga0495613_0052816
308 Ga0495674_0007026
309 Ga0495674_0007679
310 Ga0495676_0002290
311 Ga0495675_0106727
312 Ga0495684_0047774
313 Ga0495684_0312350
314 Ga0496102_0123201
315 Ga0496110_0140839
316 Ga0496110_0409938
317 Ga0496115_0002091
318 Ga0501223_017187
319 Ga0501257_000138
320 Ga0501083_0001577
321 Ga0501280_010730
322 Ga0500568_0021054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

154

365

0.99

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

18

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eez-assembly1.cif.gz_F crystal structure of alanine dehydrogenase from themus thermophilus 0.981 1 365
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9797 1 365
2vhx-assembly1.cif.gz_C crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9793 1 365
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9763 1 365
8hye-assembly1.cif.gz_C-2 structure of amino acid dehydrogenase-2752 with ligand 0.9762 1 363
ID Description Score Start End Superfamily
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9993 3 113 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9891 3 109 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9822 1 126 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9816 3 113 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 129 302 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V2RNS3-F1-model_v4 deleted 0.9989 1 133
AF-A0A1C5F701-F1-model_v4 L-alanine dehydrogenase 0.9983 1 116 GO:0000286
GO:0005886
GO:0006524
AF-A0A432IQF1-F1-model_v4 deleted 0.9982 1 116
AF-A0A3G9M6A5-F1-model_v4 deleted 0.9972 2 119
AF-A0A2M7GWY1-F1-model_v4 Alanine dehydrogenase 0.9971 1 110 GO:0000286
GO:0005886
GO:0006524

Map