F237338

General Info

Members Datasets Scaffolds Average Seq Length
161 118 322 143

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_11501969|Ga0307413_115019691
Length 168
Sequence MRVPEMKKARQSTSFICQEICYNSPMAEPKTKATKESVKDFLSKVEPAEKRQDSFRLLEMFEKITGEKVVMWGTSIVGFGQYHYKSERSKQEGDWMLVGFSPRKQNLTLYILHGNQDNPALEKLGKHKTSSGGMGGCLYINKLSDVDQKVLSKLIETSYRAMKKVAKQ

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
80 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
107 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
108 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
116 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
117 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
118 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.43
Nodule 0
Rhizoplane 0.62
Rhizosphere 68.32
Stem 0
Stem Tuber 0
Unclassified 16.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_11501969 3300031824 Bacteria 596
2 rootL2_10162797 3300003322 Bacteria 1838
3 Ga0065704_10580745 3300005289 Bacteria 618
4 Ga0065704_10805079 3300005289 Bacteria 523
5 Ga0065707_10236414 3300005295 Bacteria 1171
6 Ga0070689_100004295 3300005340 Bacteria 9615
7 Ga0070689_100335093 3300005340 Bacteria 1266
8 Ga0070689_101524460 3300005340 Bacteria 606
9 Ga0070668_100369354 3300005347 Unclassified 1218
10 Ga0070671_100000001 3300005355 Bacteria 1228151
11 Ga0070667_100004707 3300005367 Bacteria 11444
12 Ga0070667_100574429 3300005367 Bacteria 1037
13 Ga0070705_100266192 3300005440 Bacteria 1212
14 Ga0070700_100470626 3300005441 Bacteria 960
15 Ga0070694_100300521 3300005444 Unclassified 1230
16 Ga0068867_101105753 3300005459 Bacteria 724
17 Ga0070707_100253945 3300005468 Unclassified 1711
18 Ga0070698_100183491 3300005471 Bacteria 2030
19 Ga0070698_100451334 3300005471 Bacteria 1221
20 Ga0070699_100943209 3300005518 Unclassified 791
21 Ga0070686_100000980 3300005544 Bacteria 16454
22 Ga0070686_100058708 3300005544 Bacteria 2476
23 Ga0070695_100079461 3300005545 Bacteria 2165
24 Ga0070695_100491904 3300005545 Unclassified 947
25 Ga0070704_100810921 3300005549 Bacteria 837
26 Ga0068855_100097145 3300005563 Bacteria 3393
27 Ga0068857_100052577 3300005577 Unclassified 3614
28 Ga0068856_100448241 3300005614 Bacteria 1311
29 Ga0068859_101015671 3300005617 Bacteria 911
30 Ga0068870_11014916 3300005840 Unclassified 592
31 Ga0068858_100643315 3300005842 Bacteria 1030
32 Ga0068860_100062293 3300005843 Bacteria 3544
33 Ga0068860_100327889 3300005843 Bacteria 1503
34 Ga0068862_100270096 3300005844 Bacteria 1555
35 Ga0075365_10000039 3300006038 Bacteria 48317
36 Ga0075365_10000893 3300006038 Bacteria 12492
37 Ga0075363_100184295 3300006048 Unclassified 1189
38 Ga0075364_10000667 3300006051 Bacteria 17775
39 Ga0075364_10004562 3300006051 Bacteria 7972
40 Ga0075364_10006962 3300006051 Bacteria 6680
41 Ga0075367_10000309 3300006178 Bacteria 17227
42 Ga0075367_10005340 3300006178 Bacteria 6366
43 Ga0075369_10000516 3300006186 Bacteria 12102
44 Ga0075366_10013792 3300006195 Bacteria 4607
45 Ga0075366_10053501 3300006195 Bacteria 2398
46 Ga0075366_10073420 3300006195 Bacteria 2039
47 Ga0075433_11169681 3300006852 Bacteria 668
48 Ga0075434_100629468 3300006871 Bacteria 1091
49 Ga0075429_100121682 3300006880 Bacteria 2281
50 Ga0097620_101015468 3300006931 Bacteria 911
51 Ga0105240_10481031 3300009093 Bacteria 1384
52 Ga0111539_10006622 3300009094 Bacteria 14926
53 Ga0111539_12024067 3300009094 Bacteria 668
54 Ga0111539_12960361 3300009094 Bacteria 549
55 Ga0105245_10124800 3300009098 Bacteria 2408
56 Ga0105247_10656984 3300009101 Bacteria 784
57 Ga0114129_10561574 3300009147 Unclassified 1483
58 Ga0105243_10842588 3300009148 Unclassified 907
59 Ga0105241_10074447 3300009174 Bacteria 2644
60 Ga0105248_10772566 3300009177 Bacteria 1084
61 Ga0105249_10580951 3300009553 Bacteria 1174
62 Ga0105249_12846220 3300009553 Bacteria 555
63 Ga0105030_101042 3300009987 Unclassified 2473
64 Ga0157373_11366147 3300013100 Bacteria 538
65 Ga0157374_10793933 3300013296 Unclassified 962
66 Ga0157378_10243453 3300013297 Bacteria 1719
67 Ga0157378_12138115 3300013297 Bacteria 610
68 Ga0157378_12325914 3300013297 Unclassified 587
69 Ga0163162_11895907 3300013306 Bacteria 682
70 Ga0157379_10610501 3300014968 Bacteria 1019
71 Ga0207695_10666429 3300025913 Bacteria 921
72 Ga0207646_11386390 3300025922 Bacteria 612
73 Ga0207681_11569171 3300025923 Bacteria 551
74 Ga0207644_10000001 3300025931 Bacteria 1243214
75 Ga0207709_10125572 3300025935 Unclassified 1740
76 Ga0207670_10046127 3300025936 Bacteria 2893
77 Ga0207670_10480728 3300025936 Bacteria 1006
78 Ga0207667_10090451 3300025949 Bacteria 3163
79 Ga0207712_11246470 3300025961 Bacteria 664
80 Ga0207668_10615203 3300025972 Unclassified 947
81 Ga0207658_10006615 3300025986 Bacteria 7898
82 Ga0207703_11272734 3300026035 Unclassified 707
83 Ga0207708_10902717 3300026075 Bacteria 765
84 Ga0207702_11717733 3300026078 Bacteria 620
85 Ga0207674_10025145 3300026116 Bacteria 6354
86 Ga0207674_10902721 3300026116 Bacteria 852
87 Ga0209813_10001390 3300027866 Bacteria 5451
88 Ga0207428_10020381 3300027907 Bacteria 5634
89 Ga0268265_10236058 3300028380 Bacteria 1610
90 Ga0268264_10031517 3300028381 Bacteria 4345
91 Ga0316183_1067656 3300030742 Bacteria 1783
92 Ga0307408_100307881 3300031548 Bacteria 1330
93 Ga0307409_102555781 3300031995 Bacteria 539
94 Ga0307416_101054012 3300032002 Bacteria 917
95 Ga0307415_100997441 3300032126 Bacteria 778
96 Ga0373959_0129882 3300034820 Bacteria 623
97 Ga0373940_0112878 3300035088 Bacteria 836
98 Ga0373939_0102793 3300035114 Bacteria 983
99 Ga0451807_2672866 3300041486 Unclassified 651
100 Ga0450906_005931 3300042145 Bacteria 2487
101 Ga0450909_001370 3300042185 Bacteria 3387
102 Ga0453683_0146877 3300044673 Unclassified 1489
103 Ga0453683_0311687 3300044673 Bacteria 1007
104 Ga0453683_0507964 3300044673 Bacteria 782
105 Ga0453684_0634431 3300044712 Bacteria 1167
106 Ga0453684_1584849 3300044712 Unclassified 673
107 Ga0451576_0016839 3300045051 Bacteria 8059
108 Ga0451576_0196039 3300045051 Bacteria 2110
109 Ga0451576_1224905 3300045051 Unclassified 783
110 Ga0495638_0108785 3300046460 Bacteria 1648
111 Ga0495583_0018815 3300046506 Bacteria 3625
112 Ga0495660_0000005 3300046810 Bacteria 574567
113 Ga0501071_0302951 3300049587 Unclassified 1212
114 Ga0501075_0880200 3300049591 Unclassified 681
115 Ga0501261_017695 3300049690 Bacteria 999
116 Ga0501081_0578467 3300049743 Unclassified 840
117 Ga0501280_000029 3300049776 Bacteria 45812
118 nmdc:mga03n38_345107_c1 3300050490 Bacteria 809
119 nmdc:mga00v17_2044_c1 3300050491 Bacteria 10385
120 nmdc:mga00v17_260346_c1 3300050491 Unclassified 1125
121 nmdc:mga00v17_6612_c1 3300050491 Bacteria 6154
122 nmdc:mga00v17_7666_c1 3300050491 Bacteria 5105
123 nmdc:mga00v17_766_c1 3300050491 Bacteria 17434
124 nmdc:mga0yw44_1216385_c1 3300050492 Bacteria 508
125 nmdc:mga0yw44_214_c1 3300050492 Bacteria 20542
126 nmdc:mga0yw44_33_c1 3300050492 Bacteria 48347
127 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
128 nmdc:mga0yw44_658681_c1 3300050492 Bacteria 711
129 nmdc:mga0k408_1364_c1 3300050493 Bacteria 13164
130 nmdc:mga0k408_17381_c1 3300050493 Bacteria 2411
131 nmdc:mga0k408_243364_c2 3300050493 Bacteria 782
132 nmdc:mga06z11_38724_c1 3300050494 Unclassified 2369
133 nmdc:mga06z11_519356_c1 3300050494 Bacteria 722
134 nmdc:mga04h51_434_c1 3300050495 Bacteria 10060
135 nmdc:mga07m45_15061_c1 3300050496 Bacteria 4130
136 nmdc:mga09592_87608_c1 3300050508 Bacteria 2658
137 nmdc:mga0qj67_903999_c1 3300050509 Bacteria 695
138 nmdc:mga06r32_1178756_c1 3300050510 Bacteria 713
139 nmdc:mga06r32_610554_c1 3300050510 Bacteria 1061
140 nmdc:mga08y16_30267_c1 3300050511 Bacteria 5699
141 nmdc:mga08y16_706634_c1 3300050511 Bacteria 1007
142 nmdc:mga0n895_576527_c1 3300050512 Bacteria 1129
143 nmdc:mga0a205_936342_c1 3300050515 Bacteria 713
144 nmdc:mga0sz30_5907_c1 3300050516 Bacteria 4517
145 Ga0500644_0000471 3300053088 Bacteria 17804
146 Ga0500644_0019165 3300053088 Bacteria 2016
147 Ga0500646_0000007 3300053090 Bacteria 115744
148 Ga0500583_0000275 3300053092 Bacteria 18094
149 Ga0500583_0132175 3300053092 Bacteria 1238
150 Ga0500641_0000001 3300053096 Bacteria 1115973
151 Ga0500641_0005100 3300053096 Bacteria 4655
152 Ga0500650_0015363 3300053098 Bacteria 3260
153 Ga0500652_000001 3300053131 Bacteria 946868
154 Ga0500568_0007018 3300053139 Bacteria 5570
155 Ga0500577_0000124 3300053142 Bacteria 18743
156 Ga0500616_0000008 3300053153 Bacteria 785239
157 Ga0500616_0000012 3300053153 Bacteria 681798
158 Ga0500620_098500 3300053155 Bacteria 1022
159 Ga0500649_046652 3300053722 Unclassified 1825
160 Ga0500570_168694 3300053724 Unclassified 735
161 Ga0500613_003181 3300053738 Bacteria 1393
162 Ga0307413_11501969
163 rootL2_10162797
164 Ga0065704_10580745
165 Ga0065704_10805079
166 Ga0065707_10236414
167 Ga0070689_100004295
168 Ga0070689_100335093
169 Ga0070689_101524460
170 Ga0070668_100369354
171 Ga0070671_100000001
172 Ga0070667_100004707
173 Ga0070667_100574429
174 Ga0070705_100266192
175 Ga0070700_100470626
176 Ga0070694_100300521
177 Ga0068867_101105753
178 Ga0070707_100253945
179 Ga0070698_100183491
180 Ga0070698_100451334
181 Ga0070699_100943209
182 Ga0070686_100000980
183 Ga0070686_100058708
184 Ga0070695_100079461
185 Ga0070695_100491904
186 Ga0070704_100810921
187 Ga0068855_100097145
188 Ga0068857_100052577
189 Ga0068856_100448241
190 Ga0068859_101015671
191 Ga0068870_11014916
192 Ga0068858_100643315
193 Ga0068860_100062293
194 Ga0068860_100327889
195 Ga0068862_100270096
196 Ga0075365_10000039
197 Ga0075365_10000893
198 Ga0075363_100184295
199 Ga0075364_10000667
200 Ga0075364_10004562
201 Ga0075364_10006962
202 Ga0075367_10000309
203 Ga0075367_10005340
204 Ga0075369_10000516
205 Ga0075366_10013792
206 Ga0075366_10053501
207 Ga0075366_10073420
208 Ga0075433_11169681
209 Ga0075434_100629468
210 Ga0075429_100121682
211 Ga0097620_101015468
212 Ga0105240_10481031
213 Ga0111539_10006622
214 Ga0111539_12024067
215 Ga0111539_12960361
216 Ga0105245_10124800
217 Ga0105247_10656984
218 Ga0114129_10561574
219 Ga0105243_10842588
220 Ga0105241_10074447
221 Ga0105248_10772566
222 Ga0105249_10580951
223 Ga0105249_12846220
224 Ga0105030_101042
225 Ga0157373_11366147
226 Ga0157374_10793933
227 Ga0157378_10243453
228 Ga0157378_12138115
229 Ga0157378_12325914
230 Ga0163162_11895907
231 Ga0157379_10610501
232 Ga0207695_10666429
233 Ga0207646_11386390
234 Ga0207681_11569171
235 Ga0207644_10000001
236 Ga0207709_10125572
237 Ga0207670_10046127
238 Ga0207670_10480728
239 Ga0207667_10090451
240 Ga0207712_11246470
241 Ga0207668_10615203
242 Ga0207658_10006615
243 Ga0207703_11272734
244 Ga0207708_10902717
245 Ga0207702_11717733
246 Ga0207674_10025145
247 Ga0207674_10902721
248 Ga0209813_10001390
249 Ga0207428_10020381
250 Ga0268265_10236058
251 Ga0268264_10031517
252 Ga0316183_1067656
253 Ga0307408_100307881
254 Ga0307409_102555781
255 Ga0307416_101054012
256 Ga0307415_100997441
257 Ga0373959_0129882
258 Ga0373940_0112878
259 Ga0373939_0102793
260 Ga0451807_2672866
261 Ga0450906_005931
262 Ga0450909_001370
263 Ga0453683_0146877
264 Ga0453683_0311687
265 Ga0453683_0507964
266 Ga0453684_0634431
267 Ga0453684_1584849
268 Ga0451576_0016839
269 Ga0451576_0196039
270 Ga0451576_1224905
271 Ga0495638_0108785
272 Ga0495583_0018815
273 Ga0495660_0000005
274 Ga0501071_0302951
275 Ga0501075_0880200
276 Ga0501261_017695
277 Ga0501081_0578467
278 Ga0501280_000029
279 nmdc:mga03n38_345107_c1
280 nmdc:mga00v17_2044_c1
281 nmdc:mga00v17_260346_c1
282 nmdc:mga00v17_6612_c1
283 nmdc:mga00v17_7666_c1
284 nmdc:mga00v17_766_c1
285 nmdc:mga0yw44_1216385_c1
286 nmdc:mga0yw44_214_c1
287 nmdc:mga0yw44_33_c1
288 nmdc:mga0yw44_4_c1
289 nmdc:mga0yw44_658681_c1
290 nmdc:mga0k408_1364_c1
291 nmdc:mga0k408_17381_c1
292 nmdc:mga0k408_243364_c2
293 nmdc:mga06z11_38724_c1
294 nmdc:mga06z11_519356_c1
295 nmdc:mga04h51_434_c1
296 nmdc:mga07m45_15061_c1
297 nmdc:mga09592_87608_c1
298 nmdc:mga0qj67_903999_c1
299 nmdc:mga06r32_1178756_c1
300 nmdc:mga06r32_610554_c1
301 nmdc:mga08y16_30267_c1
302 nmdc:mga08y16_706634_c1
303 nmdc:mga0n895_576527_c1
304 nmdc:mga0a205_936342_c1
305 nmdc:mga0sz30_5907_c1
306 Ga0500644_0000471
307 Ga0500644_0019165
308 Ga0500646_0000007
309 Ga0500583_0000275
310 Ga0500583_0132175
311 Ga0500641_0000001
312 Ga0500641_0005100
313 Ga0500650_0015363
314 Ga0500652_000001
315 Ga0500568_0007018
316 Ga0500577_0000124
317 Ga0500616_0000008
318 Ga0500616_0000012
319 Ga0500620_098500
320 Ga0500649_046652
321 Ga0500570_168694
322 Ga0500613_003181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

50

159

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6548 15 133
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6347 15 136
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6043 15 133
4rf8-assembly1.cif.gz_A crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with adp 0.5977 81 137
4rf9-assembly1.cif.gz_A crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with l-arginine and atpgs 0.5701 81 137
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6396 15 126 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6328 13 134 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6016 13 134 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5722 15 126 3.90.1150.200
af_P0AEX5_1_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5356 81 138 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7T8YSV3-F1-model_v4 deleted 0.9772 1 138
AF-A0A7Y5V4N3-F1-model_v4 DUF1801 domain-containing protein 0.9715 1 138
AF-A0A1E5T148-F1-model_v4 YdhG-like domain-containing protein 0.9706 1 138
AF-A0A258H2N7-F1-model_v4 YdhG-like domain-containing protein 0.9699 1 137
AF-A0A518RJZ1-F1-model_v4 DUF1801 domain-containing protein 0.9696 1 140

Map