F237645

General Info

Members Datasets Scaffolds Average Seq Length
161 107 322 370

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0002564|Ga0495650_0002564_5035_6231
Length 398
Sequence LSPFLERLRETFDFVQRPLRIDRRMRVGVIGGGQLARMMVPPAVELGVEIRVLAESAGMSAAIAATAVGDYRDLDTVLAFAADVDVITFDHEHVPQNVLAALVAAGHAVHPGPDALAVAQDKIVMRERLTGIGAPVPDWAVVHDKPALGVFLRSHGGQAVVKTPRGGYDGKGVRVVRAADAADDWLALAAAGTGEGLLVEELVDFRRELAQLVARRPSGEVRAWPLVETVQRDGVCAEVFAPAPSAGELPAAARALAERIAAELGVTGVLAVELFETSDGALLINELAMRPHNTGHWTIDGAVTSQFEQHLRAVLDLPLGDPSPIAPWSVMVNILGGPAGETMPDRYGVAFADRPEVKFHSYGKESRAGRKVGHVTALGSELDDTVARARAAAGFFQA

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
52 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
53 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
54 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
55 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
56 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
57 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
73 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
85 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
86 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
87 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
88 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
89 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
92 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
93 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
94 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
95 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
96 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
97 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
98 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
99 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
100 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
101 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
102 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
103 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
104 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
105 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
106 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
107 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 11.18
Nodule 0
Rhizoplane 0.62
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0002564 3300046471 Bacteria 14394
2 Ga0070658_10000771 3300005327 Bacteria 27511
3 Ga0070658_10001837 3300005327 Bacteria 17861
4 Ga0068868_100027875 3300005338 Bacteria 4312
5 Ga0070659_100004794 3300005366 Bacteria 9667
6 Ga0070667_100011033 3300005367 Bacteria 7473
7 Ga0068853_100021433 3300005539 Bacteria 5388
8 Ga0068855_100002245 3300005563 Bacteria 23878
9 Ga0068857_100000025 3300005577 Bacteria 84312
10 Ga0068857_100181295 3300005577 Bacteria 1917
11 Ga0068856_100042981 3300005614 Bacteria 4446
12 Ga0068856_100082870 3300005614 Bacteria 3183
13 Ga0068852_100001068 3300005616 Bacteria 18099
14 Ga0068859_100151058 3300005617 Bacteria 2398
15 Ga0068864_100008708 3300005618 Bacteria 8370
16 Ga0068851_10000001 3300005834 Bacteria 495512
17 Ga0068858_100000048 3300005842 Bacteria 126360
18 Ga0075365_10063793 3300006038 Bacteria 2467
19 Ga0075364_10002836 3300006051 Bacteria 9762
20 Ga0097620_100151059 3300006931 Bacteria 2398
21 Ga0105240_10000538 3300009093 Bacteria 70068
22 Ga0105245_10040706 3300009098 Bacteria 4141
23 Ga0105245_10060767 3300009098 Bacteria 3404
24 Ga0105241_10000768 3300009174 Bacteria 24407
25 Ga0105248_10000124 3300009177 Bacteria 88479
26 Ga0105248_10057950 3300009177 Bacteria 4349
27 Ga0105237_10000217 3300009545 Bacteria 80966
28 Ga0105237_10044854 3300009545 Bacteria 4451
29 Ga0105237_10116309 3300009545 Bacteria 2667
30 Ga0105238_10004324 3300009551 Bacteria 14093
31 Ga0163163_10005047 3300014325 Bacteria 11376
32 Ga0157379_10004915 3300014968 Bacteria 11478
33 Ga0209148_1000857 3300025254 Bacteria 21284
34 Ga0209148_1010223 3300025254 Bacteria 1790
35 Ga0207656_10000002 3300025321 Bacteria 792178
36 Ga0207705_10039270 3300025909 Bacteria 3392
37 Ga0207705_10098101 3300025909 Bacteria 2152
38 Ga0207654_10000001 3300025911 Bacteria 1816198
39 Ga0207695_10000983 3300025913 Bacteria 50658
40 Ga0207695_10029946 3300025913 Bacteria 6003
41 Ga0207671_10000002 3300025914 Bacteria 1144816
42 Ga0207671_10101246 3300025914 Bacteria 2182
43 Ga0207657_10207394 3300025919 Bacteria 1574
44 Ga0207657_10305237 3300025919 Bacteria 1260
45 Ga0207694_10000022 3300025924 Bacteria 288900
46 Ga0207687_10015621 3300025927 Bacteria 4980
47 Ga0207690_10002240 3300025932 Bacteria 11805
48 Ga0207711_10000940 3300025941 Bacteria 28075
49 Ga0207711_10038717 3300025941 Bacteria 4055
50 Ga0207667_10000467 3300025949 Bacteria 54059
51 Ga0207667_10006145 3300025949 Bacteria 14589
52 Ga0207667_10416513 3300025949 Bacteria 1367
53 Ga0207677_10044437 3300026023 Bacteria 2960
54 Ga0207703_10000064 3300026035 Bacteria 126619
55 Ga0207639_10026688 3300026041 Bacteria 4198
56 Ga0207639_10028960 3300026041 Bacteria 4049
57 Ga0207702_10230270 3300026078 Bacteria 1731
58 Ga0207641_10262612 3300026088 Bacteria 1617
59 Ga0207674_10000153 3300026116 Bacteria 80955
60 Ga0207674_10121790 3300026116 Bacteria 2575
61 Ga0207698_10000695 3300026142 Bacteria 19531
62 Ga0207698_10001040 3300026142 Bacteria 16156
63 Ga0207698_10055293 3300026142 Bacteria 3058
64 Ga0268265_10304213 3300028380 Bacteria 1437
65 Ga0307515_10171142 3300028794 Bacteria 2164
66 Ga0466965_0000008 3300044683 Bacteria 131465
67 Ga0466970_0016715 3300044765 Bacteria 3786
68 Ga0495590_0000095 3300046457 Bacteria 54200
69 Ga0496102_0057498 3300048905 Bacteria 3552
70 Ga0496117_0025371 3300048920 Bacteria 4663
71 Ga0496117_0079179 3300048920 Bacteria 2166
72 Ga0496117_0081633 3300048920 Bacteria 2121
73 Ga0496118_0000240 3300048921 Bacteria 96796
74 Ga0496119_0000552 3300048922 Bacteria 51035
75 Ga0496119_0003586 3300048922 Bacteria 16007
76 Ga0496119_0009138 3300048922 Bacteria 8573
77 Ga0496119_0026907 3300048922 Bacteria 3973
78 Ga0496120_0000586 3300048923 Bacteria 55320
79 Ga0496120_0013380 3300048923 Bacteria 5528
80 Ga0496120_0054181 3300048923 Bacteria 2275
81 Ga0496121_0000025 3300048924 Bacteria 453467
82 Ga0496121_0085587 3300048924 Bacteria 2481
83 Ga0496122_0018654 3300048925 Bacteria 6389
84 Ga0496124_0000070 3300048927 Bacteria 220875
85 Ga0496124_0005025 3300048927 Bacteria 15122
86 Ga0496126_0260242 3300048929 Bacteria 1443
87 Ga0501031_0016462 3300049568 Bacteria 4803
88 Ga0501032_0004923 3300049569 Bacteria 9993
89 Ga0501032_0009568 3300049569 Bacteria 7027
90 Ga0501032_0108640 3300049569 Bacteria 1837
91 Ga0501033_0051546 3300049570 Bacteria 3050
92 Ga0501033_0074658 3300049570 Bacteria 2489
93 Ga0501033_0080908 3300049570 Bacteria 2383
94 Ga0501034_0005219 3300049571 Bacteria 14253
95 Ga0501034_0037210 3300049571 Bacteria 4927
96 Ga0501034_0045942 3300049571 Bacteria 4412
97 Ga0501034_0058616 3300049571 Bacteria 3869
98 Ga0501034_0087339 3300049571 Bacteria 3118
99 Ga0501034_0111103 3300049571 Bacteria 2731
100 Ga0501034_0292180 3300049571 Bacteria 1567
101 Ga0501036_0011348 3300049572 Bacteria 7373
102 Ga0501036_0086130 3300049572 Bacteria 2656
103 Ga0501037_0004573 3300049573 Bacteria 10053
104 Ga0501037_0039483 3300049573 Bacteria 3475
105 Ga0501037_0085410 3300049573 Bacteria 2285
106 Ga0501037_0097228 3300049573 Bacteria 2127
107 Ga0501038_0005112 3300049574 Bacteria 12193
108 Ga0501038_0009705 3300049574 Bacteria 8826
109 Ga0501039_0000795 3300049575 Bacteria 22728
110 Ga0501039_0256419 3300049575 Bacteria 1375
111 Ga0501042_0010823 3300049578 Bacteria 6133
112 Ga0501043_0008566 3300049579 Bacteria 8062
113 Ga0501043_0013804 3300049579 Bacteria 6321
114 Ga0501046_0024069 3300049580 Bacteria 5000
115 Ga0501047_0011531 3300049581 Bacteria 8366
116 Ga0501047_0032549 3300049581 Bacteria 5033
117 Ga0501047_0041800 3300049581 Bacteria 4429
118 Ga0501048_0029710 3300049582 Bacteria 3961
119 Ga0501068_0062567 3300049584 Bacteria 2263
120 Ga0501069_0024649 3300049585 Bacteria 3282
121 Ga0501070_0002060 3300049586 Bacteria 17668
122 Ga0501070_0004283 3300049586 Bacteria 12269
123 Ga0501070_0030237 3300049586 Bacteria 4539
124 Ga0501071_0000500 3300049587 Bacteria 19926
125 Ga0501072_0015545 3300049588 Bacteria 5832
126 Ga0501073_0000012 3300049589 Bacteria 161319
127 Ga0501080_0003641 3300049742 Bacteria 13594
128 Ga0501083_0000053 3300049744 Bacteria 83252
129 Ga0501083_0043014 3300049744 Bacteria 3061
130 Ga0501035_0051992 3300049822 Bacteria 3666
131 Ga0501044_0038195 3300049823 Bacteria 5015
132 Ga0501044_0111938 3300049823 Bacteria 2737
133 Ga0501045_0015063 3300049824 Bacteria 5488
134 nmdc:mga00v17_2839_c1 3300050491 Bacteria 8899
135 Ga0500635_0001968 3300053080 Bacteria 5014
136 Ga0500556_0000085 3300053104 Bacteria 87978
137 Ga0500562_007429 3300053108 Bacteria 2764
138 Ga0500593_000817 3300053117 Bacteria 11641
139 Ga0500655_002449 3300053133 Bacteria 3381
140 Ga0500559_0000163 3300053136 Bacteria 52657
141 Ga0500568_0000161 3300053139 Bacteria 57643
142 Ga0500568_0000165 3300053139 Bacteria 57124
143 Ga0500573_0000630 3300053140 Bacteria 15504
144 Ga0500573_0002097 3300053140 Bacteria 9817
145 Ga0500616_0000109 3300053153 Bacteria 152604
146 Ga0500616_0004320 3300053153 Bacteria 10184
147 Ga0500620_000282 3300053155 Bacteria 9868
148 2587863830 2585428094 Bacteria 3604039
149 2753302594 2751185788 Bacteria 4541048
150 2857737538 2857737099 Bacteria 3104305
151 2862994707 2862993130 Bacteria 3860849
152 2897562202 2897561785 Bacteria 3256946
153 2904433587 2904430863 Bacteria 3486923
154 2904503889 2904501621 Bacteria 3401437
155 2908676855 2908674828 Bacteria 3382763
156 2909076958 2909074476 Bacteria 3436050
157 2919039570 2919039151 Bacteria 3391018
158 2919042964 2919042368 Bacteria 3905917
159 2928105918 2928104781 Bacteria 3877447
160 2928501997 2928500415 Bacteria 3384541
161 2984554752 2984551494 Bacteria 3877562
162 Ga0495650_0002564
163 Ga0070658_10000771
164 Ga0070658_10001837
165 Ga0068868_100027875
166 Ga0070659_100004794
167 Ga0070667_100011033
168 Ga0068853_100021433
169 Ga0068855_100002245
170 Ga0068857_100000025
171 Ga0068857_100181295
172 Ga0068856_100042981
173 Ga0068856_100082870
174 Ga0068852_100001068
175 Ga0068859_100151058
176 Ga0068864_100008708
177 Ga0068851_10000001
178 Ga0068858_100000048
179 Ga0075365_10063793
180 Ga0075364_10002836
181 Ga0097620_100151059
182 Ga0105240_10000538
183 Ga0105245_10040706
184 Ga0105245_10060767
185 Ga0105241_10000768
186 Ga0105248_10000124
187 Ga0105248_10057950
188 Ga0105237_10000217
189 Ga0105237_10044854
190 Ga0105237_10116309
191 Ga0105238_10004324
192 Ga0163163_10005047
193 Ga0157379_10004915
194 Ga0209148_1000857
195 Ga0209148_1010223
196 Ga0207656_10000002
197 Ga0207705_10039270
198 Ga0207705_10098101
199 Ga0207654_10000001
200 Ga0207695_10000983
201 Ga0207695_10029946
202 Ga0207671_10000002
203 Ga0207671_10101246
204 Ga0207657_10207394
205 Ga0207657_10305237
206 Ga0207694_10000022
207 Ga0207687_10015621
208 Ga0207690_10002240
209 Ga0207711_10000940
210 Ga0207711_10038717
211 Ga0207667_10000467
212 Ga0207667_10006145
213 Ga0207667_10416513
214 Ga0207677_10044437
215 Ga0207703_10000064
216 Ga0207639_10026688
217 Ga0207639_10028960
218 Ga0207702_10230270
219 Ga0207641_10262612
220 Ga0207674_10000153
221 Ga0207674_10121790
222 Ga0207698_10000695
223 Ga0207698_10001040
224 Ga0207698_10055293
225 Ga0268265_10304213
226 Ga0307515_10171142
227 Ga0466965_0000008
228 Ga0466970_0016715
229 Ga0495590_0000095
230 Ga0496102_0057498
231 Ga0496117_0025371
232 Ga0496117_0079179
233 Ga0496117_0081633
234 Ga0496118_0000240
235 Ga0496119_0000552
236 Ga0496119_0003586
237 Ga0496119_0009138
238 Ga0496119_0026907
239 Ga0496120_0000586
240 Ga0496120_0013380
241 Ga0496120_0054181
242 Ga0496121_0000025
243 Ga0496121_0085587
244 Ga0496122_0018654
245 Ga0496124_0000070
246 Ga0496124_0005025
247 Ga0496126_0260242
248 Ga0501031_0016462
249 Ga0501032_0004923
250 Ga0501032_0009568
251 Ga0501032_0108640
252 Ga0501033_0051546
253 Ga0501033_0074658
254 Ga0501033_0080908
255 Ga0501034_0005219
256 Ga0501034_0037210
257 Ga0501034_0045942
258 Ga0501034_0058616
259 Ga0501034_0087339
260 Ga0501034_0111103
261 Ga0501034_0292180
262 Ga0501036_0011348
263 Ga0501036_0086130
264 Ga0501037_0004573
265 Ga0501037_0039483
266 Ga0501037_0085410
267 Ga0501037_0097228
268 Ga0501038_0005112
269 Ga0501038_0009705
270 Ga0501039_0000795
271 Ga0501039_0256419
272 Ga0501042_0010823
273 Ga0501043_0008566
274 Ga0501043_0013804
275 Ga0501046_0024069
276 Ga0501047_0011531
277 Ga0501047_0032549
278 Ga0501047_0041800
279 Ga0501048_0029710
280 Ga0501068_0062567
281 Ga0501069_0024649
282 Ga0501070_0002060
283 Ga0501070_0004283
284 Ga0501070_0030237
285 Ga0501071_0000500
286 Ga0501072_0015545
287 Ga0501073_0000012
288 Ga0501080_0003641
289 Ga0501083_0000053
290 Ga0501083_0043014
291 Ga0501035_0051992
292 Ga0501044_0038195
293 Ga0501044_0111938
294 Ga0501045_0015063
295 nmdc:mga00v17_2839_c1
296 Ga0500635_0001968
297 Ga0500556_0000085
298 Ga0500562_007429
299 Ga0500593_000817
300 Ga0500655_002449
301 Ga0500559_0000163
302 Ga0500568_0000161
303 Ga0500568_0000165
304 Ga0500573_0000630
305 Ga0500573_0002097
306 Ga0500616_0000109
307 Ga0500616_0004320
308 Ga0500620_000282
309 2587863830
310 2753302594
311 2857737538
312 2862994707
313 2897562202
314 2904433587
315 2904503889
316 2908676855
317 2909076958
318 2919039570
319 2919042964
320 2928105918
321 2928501997
322 2984554752

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02222

ATP-grasp

ATP-grasp domain

129

302

0.97

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

24

120

0.92

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

329

388

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.9275 3 371
3qff-assembly1.cif.gz_B crystal structure of adp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase 0.9167 2 365
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.9127 3 371
4ma5-assembly1.cif.gz_A-2 the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. 0.9117 1 371
4ma5-assembly1.cif.gz_A-2 the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. 0.9069 1 371
ID Description Score Start End Superfamily
af_P9WHL9_202_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9657 182 368 3.30.470.20
3qffB03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9321 176 365 3.30.470.20
af_P9WHL9_202_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9316 182 368 3.30.470.20
af_A0A1D6MHA0_260_452_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9291 178 364 3.30.470.20
af_P9WHL9_13_120_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9288 2 101 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A3Q9J7H3-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (EC 6.3.4.18) 0.9746 243 370 GO:0005829
GO:0034028
AF-A0A7W1B3U0-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9699 2 368 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872
AF-A0A6A9UUW8-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9693 2 368 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872
AF-A0A413RJ33-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9675 2 368 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872
AF-A0A2W5CCM5-F1-model_v4 deleted 0.9669 2 366

Map