F237645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 161 | 107 | 322 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0002564|Ga0495650_0002564_5035_6231 |
| Length | 398 |
| Sequence | LSPFLERLRETFDFVQRPLRIDRRMRVGVIGGGQLARMMVPPAVELGVEIRVLAESAGMSAAIAATAVGDYRDLDTVLAFAADVDVITFDHEHVPQNVLAALVAAGHAVHPGPDALAVAQDKIVMRERLTGIGAPVPDWAVVHDKPALGVFLRSHGGQAVVKTPRGGYDGKGVRVVRAADAADDWLALAAAGTGEGLLVEELVDFRRELAQLVARRPSGEVRAWPLVETVQRDGVCAEVFAPAPSAGELPAAARALAERIAAELGVTGVLAVELFETSDGALLINELAMRPHNTGHWTIDGAVTSQFEQHLRAVLDLPLGDPSPIAPWSVMVNILGGPAGETMPDRYGVAFADRPEVKFHSYGKESRAGRKVGHVTALGSELDDTVARARAAAGFFQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 7 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 8 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 9 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 10 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 11 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 12 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 13 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 14 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 15 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 16 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 17 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 27 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 47 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 48 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 49 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 51 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 52 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 53 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 54 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 55 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 56 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 57 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 58 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 59 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 60 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 61 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 62 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 63 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 66 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 67 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 68 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 69 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 74 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 77 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 78 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 83 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 84 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 85 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 86 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 87 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 88 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 89 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 90 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 91 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 92 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 93 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 94 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 95 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 96 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 97 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 98 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 99 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 100 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 101 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 102 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 103 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 104 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 105 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 106 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 107 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.3 |
| Metatranscriptomes | 0 |
| Isolates | 8.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.62 |
| Bulb | 0 |
| Endosphere | 11.18 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 73.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495650_0002564 | 3300046471 | Bacteria | 14394 |
| 2 | Ga0070658_10000771 | 3300005327 | Bacteria | 27511 |
| 3 | Ga0070658_10001837 | 3300005327 | Bacteria | 17861 |
| 4 | Ga0068868_100027875 | 3300005338 | Bacteria | 4312 |
| 5 | Ga0070659_100004794 | 3300005366 | Bacteria | 9667 |
| 6 | Ga0070667_100011033 | 3300005367 | Bacteria | 7473 |
| 7 | Ga0068853_100021433 | 3300005539 | Bacteria | 5388 |
| 8 | Ga0068855_100002245 | 3300005563 | Bacteria | 23878 |
| 9 | Ga0068857_100000025 | 3300005577 | Bacteria | 84312 |
| 10 | Ga0068857_100181295 | 3300005577 | Bacteria | 1917 |
| 11 | Ga0068856_100042981 | 3300005614 | Bacteria | 4446 |
| 12 | Ga0068856_100082870 | 3300005614 | Bacteria | 3183 |
| 13 | Ga0068852_100001068 | 3300005616 | Bacteria | 18099 |
| 14 | Ga0068859_100151058 | 3300005617 | Bacteria | 2398 |
| 15 | Ga0068864_100008708 | 3300005618 | Bacteria | 8370 |
| 16 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 17 | Ga0068858_100000048 | 3300005842 | Bacteria | 126360 |
| 18 | Ga0075365_10063793 | 3300006038 | Bacteria | 2467 |
| 19 | Ga0075364_10002836 | 3300006051 | Bacteria | 9762 |
| 20 | Ga0097620_100151059 | 3300006931 | Bacteria | 2398 |
| 21 | Ga0105240_10000538 | 3300009093 | Bacteria | 70068 |
| 22 | Ga0105245_10040706 | 3300009098 | Bacteria | 4141 |
| 23 | Ga0105245_10060767 | 3300009098 | Bacteria | 3404 |
| 24 | Ga0105241_10000768 | 3300009174 | Bacteria | 24407 |
| 25 | Ga0105248_10000124 | 3300009177 | Bacteria | 88479 |
| 26 | Ga0105248_10057950 | 3300009177 | Bacteria | 4349 |
| 27 | Ga0105237_10000217 | 3300009545 | Bacteria | 80966 |
| 28 | Ga0105237_10044854 | 3300009545 | Bacteria | 4451 |
| 29 | Ga0105237_10116309 | 3300009545 | Bacteria | 2667 |
| 30 | Ga0105238_10004324 | 3300009551 | Bacteria | 14093 |
| 31 | Ga0163163_10005047 | 3300014325 | Bacteria | 11376 |
| 32 | Ga0157379_10004915 | 3300014968 | Bacteria | 11478 |
| 33 | Ga0209148_1000857 | 3300025254 | Bacteria | 21284 |
| 34 | Ga0209148_1010223 | 3300025254 | Bacteria | 1790 |
| 35 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 36 | Ga0207705_10039270 | 3300025909 | Bacteria | 3392 |
| 37 | Ga0207705_10098101 | 3300025909 | Bacteria | 2152 |
| 38 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 39 | Ga0207695_10000983 | 3300025913 | Bacteria | 50658 |
| 40 | Ga0207695_10029946 | 3300025913 | Bacteria | 6003 |
| 41 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 42 | Ga0207671_10101246 | 3300025914 | Bacteria | 2182 |
| 43 | Ga0207657_10207394 | 3300025919 | Bacteria | 1574 |
| 44 | Ga0207657_10305237 | 3300025919 | Bacteria | 1260 |
| 45 | Ga0207694_10000022 | 3300025924 | Bacteria | 288900 |
| 46 | Ga0207687_10015621 | 3300025927 | Bacteria | 4980 |
| 47 | Ga0207690_10002240 | 3300025932 | Bacteria | 11805 |
| 48 | Ga0207711_10000940 | 3300025941 | Bacteria | 28075 |
| 49 | Ga0207711_10038717 | 3300025941 | Bacteria | 4055 |
| 50 | Ga0207667_10000467 | 3300025949 | Bacteria | 54059 |
| 51 | Ga0207667_10006145 | 3300025949 | Bacteria | 14589 |
| 52 | Ga0207667_10416513 | 3300025949 | Bacteria | 1367 |
| 53 | Ga0207677_10044437 | 3300026023 | Bacteria | 2960 |
| 54 | Ga0207703_10000064 | 3300026035 | Bacteria | 126619 |
| 55 | Ga0207639_10026688 | 3300026041 | Bacteria | 4198 |
| 56 | Ga0207639_10028960 | 3300026041 | Bacteria | 4049 |
| 57 | Ga0207702_10230270 | 3300026078 | Bacteria | 1731 |
| 58 | Ga0207641_10262612 | 3300026088 | Bacteria | 1617 |
| 59 | Ga0207674_10000153 | 3300026116 | Bacteria | 80955 |
| 60 | Ga0207674_10121790 | 3300026116 | Bacteria | 2575 |
| 61 | Ga0207698_10000695 | 3300026142 | Bacteria | 19531 |
| 62 | Ga0207698_10001040 | 3300026142 | Bacteria | 16156 |
| 63 | Ga0207698_10055293 | 3300026142 | Bacteria | 3058 |
| 64 | Ga0268265_10304213 | 3300028380 | Bacteria | 1437 |
| 65 | Ga0307515_10171142 | 3300028794 | Bacteria | 2164 |
| 66 | Ga0466965_0000008 | 3300044683 | Bacteria | 131465 |
| 67 | Ga0466970_0016715 | 3300044765 | Bacteria | 3786 |
| 68 | Ga0495590_0000095 | 3300046457 | Bacteria | 54200 |
| 69 | Ga0496102_0057498 | 3300048905 | Bacteria | 3552 |
| 70 | Ga0496117_0025371 | 3300048920 | Bacteria | 4663 |
| 71 | Ga0496117_0079179 | 3300048920 | Bacteria | 2166 |
| 72 | Ga0496117_0081633 | 3300048920 | Bacteria | 2121 |
| 73 | Ga0496118_0000240 | 3300048921 | Bacteria | 96796 |
| 74 | Ga0496119_0000552 | 3300048922 | Bacteria | 51035 |
| 75 | Ga0496119_0003586 | 3300048922 | Bacteria | 16007 |
| 76 | Ga0496119_0009138 | 3300048922 | Bacteria | 8573 |
| 77 | Ga0496119_0026907 | 3300048922 | Bacteria | 3973 |
| 78 | Ga0496120_0000586 | 3300048923 | Bacteria | 55320 |
| 79 | Ga0496120_0013380 | 3300048923 | Bacteria | 5528 |
| 80 | Ga0496120_0054181 | 3300048923 | Bacteria | 2275 |
| 81 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 82 | Ga0496121_0085587 | 3300048924 | Bacteria | 2481 |
| 83 | Ga0496122_0018654 | 3300048925 | Bacteria | 6389 |
| 84 | Ga0496124_0000070 | 3300048927 | Bacteria | 220875 |
| 85 | Ga0496124_0005025 | 3300048927 | Bacteria | 15122 |
| 86 | Ga0496126_0260242 | 3300048929 | Bacteria | 1443 |
| 87 | Ga0501031_0016462 | 3300049568 | Bacteria | 4803 |
| 88 | Ga0501032_0004923 | 3300049569 | Bacteria | 9993 |
| 89 | Ga0501032_0009568 | 3300049569 | Bacteria | 7027 |
| 90 | Ga0501032_0108640 | 3300049569 | Bacteria | 1837 |
| 91 | Ga0501033_0051546 | 3300049570 | Bacteria | 3050 |
| 92 | Ga0501033_0074658 | 3300049570 | Bacteria | 2489 |
| 93 | Ga0501033_0080908 | 3300049570 | Bacteria | 2383 |
| 94 | Ga0501034_0005219 | 3300049571 | Bacteria | 14253 |
| 95 | Ga0501034_0037210 | 3300049571 | Bacteria | 4927 |
| 96 | Ga0501034_0045942 | 3300049571 | Bacteria | 4412 |
| 97 | Ga0501034_0058616 | 3300049571 | Bacteria | 3869 |
| 98 | Ga0501034_0087339 | 3300049571 | Bacteria | 3118 |
| 99 | Ga0501034_0111103 | 3300049571 | Bacteria | 2731 |
| 100 | Ga0501034_0292180 | 3300049571 | Bacteria | 1567 |
| 101 | Ga0501036_0011348 | 3300049572 | Bacteria | 7373 |
| 102 | Ga0501036_0086130 | 3300049572 | Bacteria | 2656 |
| 103 | Ga0501037_0004573 | 3300049573 | Bacteria | 10053 |
| 104 | Ga0501037_0039483 | 3300049573 | Bacteria | 3475 |
| 105 | Ga0501037_0085410 | 3300049573 | Bacteria | 2285 |
| 106 | Ga0501037_0097228 | 3300049573 | Bacteria | 2127 |
| 107 | Ga0501038_0005112 | 3300049574 | Bacteria | 12193 |
| 108 | Ga0501038_0009705 | 3300049574 | Bacteria | 8826 |
| 109 | Ga0501039_0000795 | 3300049575 | Bacteria | 22728 |
| 110 | Ga0501039_0256419 | 3300049575 | Bacteria | 1375 |
| 111 | Ga0501042_0010823 | 3300049578 | Bacteria | 6133 |
| 112 | Ga0501043_0008566 | 3300049579 | Bacteria | 8062 |
| 113 | Ga0501043_0013804 | 3300049579 | Bacteria | 6321 |
| 114 | Ga0501046_0024069 | 3300049580 | Bacteria | 5000 |
| 115 | Ga0501047_0011531 | 3300049581 | Bacteria | 8366 |
| 116 | Ga0501047_0032549 | 3300049581 | Bacteria | 5033 |
| 117 | Ga0501047_0041800 | 3300049581 | Bacteria | 4429 |
| 118 | Ga0501048_0029710 | 3300049582 | Bacteria | 3961 |
| 119 | Ga0501068_0062567 | 3300049584 | Bacteria | 2263 |
| 120 | Ga0501069_0024649 | 3300049585 | Bacteria | 3282 |
| 121 | Ga0501070_0002060 | 3300049586 | Bacteria | 17668 |
| 122 | Ga0501070_0004283 | 3300049586 | Bacteria | 12269 |
| 123 | Ga0501070_0030237 | 3300049586 | Bacteria | 4539 |
| 124 | Ga0501071_0000500 | 3300049587 | Bacteria | 19926 |
| 125 | Ga0501072_0015545 | 3300049588 | Bacteria | 5832 |
| 126 | Ga0501073_0000012 | 3300049589 | Bacteria | 161319 |
| 127 | Ga0501080_0003641 | 3300049742 | Bacteria | 13594 |
| 128 | Ga0501083_0000053 | 3300049744 | Bacteria | 83252 |
| 129 | Ga0501083_0043014 | 3300049744 | Bacteria | 3061 |
| 130 | Ga0501035_0051992 | 3300049822 | Bacteria | 3666 |
| 131 | Ga0501044_0038195 | 3300049823 | Bacteria | 5015 |
| 132 | Ga0501044_0111938 | 3300049823 | Bacteria | 2737 |
| 133 | Ga0501045_0015063 | 3300049824 | Bacteria | 5488 |
| 134 | nmdc:mga00v17_2839_c1 | 3300050491 | Bacteria | 8899 |
| 135 | Ga0500635_0001968 | 3300053080 | Bacteria | 5014 |
| 136 | Ga0500556_0000085 | 3300053104 | Bacteria | 87978 |
| 137 | Ga0500562_007429 | 3300053108 | Bacteria | 2764 |
| 138 | Ga0500593_000817 | 3300053117 | Bacteria | 11641 |
| 139 | Ga0500655_002449 | 3300053133 | Bacteria | 3381 |
| 140 | Ga0500559_0000163 | 3300053136 | Bacteria | 52657 |
| 141 | Ga0500568_0000161 | 3300053139 | Bacteria | 57643 |
| 142 | Ga0500568_0000165 | 3300053139 | Bacteria | 57124 |
| 143 | Ga0500573_0000630 | 3300053140 | Bacteria | 15504 |
| 144 | Ga0500573_0002097 | 3300053140 | Bacteria | 9817 |
| 145 | Ga0500616_0000109 | 3300053153 | Bacteria | 152604 |
| 146 | Ga0500616_0004320 | 3300053153 | Bacteria | 10184 |
| 147 | Ga0500620_000282 | 3300053155 | Bacteria | 9868 |
| 148 | 2587863830 | 2585428094 | Bacteria | 3604039 |
| 149 | 2753302594 | 2751185788 | Bacteria | 4541048 |
| 150 | 2857737538 | 2857737099 | Bacteria | 3104305 |
| 151 | 2862994707 | 2862993130 | Bacteria | 3860849 |
| 152 | 2897562202 | 2897561785 | Bacteria | 3256946 |
| 153 | 2904433587 | 2904430863 | Bacteria | 3486923 |
| 154 | 2904503889 | 2904501621 | Bacteria | 3401437 |
| 155 | 2908676855 | 2908674828 | Bacteria | 3382763 |
| 156 | 2909076958 | 2909074476 | Bacteria | 3436050 |
| 157 | 2919039570 | 2919039151 | Bacteria | 3391018 |
| 158 | 2919042964 | 2919042368 | Bacteria | 3905917 |
| 159 | 2928105918 | 2928104781 | Bacteria | 3877447 |
| 160 | 2928501997 | 2928500415 | Bacteria | 3384541 |
| 161 | 2984554752 | 2984551494 | Bacteria | 3877562 |
| 162 | Ga0495650_0002564 | |||
| 163 | Ga0070658_10000771 | |||
| 164 | Ga0070658_10001837 | |||
| 165 | Ga0068868_100027875 | |||
| 166 | Ga0070659_100004794 | |||
| 167 | Ga0070667_100011033 | |||
| 168 | Ga0068853_100021433 | |||
| 169 | Ga0068855_100002245 | |||
| 170 | Ga0068857_100000025 | |||
| 171 | Ga0068857_100181295 | |||
| 172 | Ga0068856_100042981 | |||
| 173 | Ga0068856_100082870 | |||
| 174 | Ga0068852_100001068 | |||
| 175 | Ga0068859_100151058 | |||
| 176 | Ga0068864_100008708 | |||
| 177 | Ga0068851_10000001 | |||
| 178 | Ga0068858_100000048 | |||
| 179 | Ga0075365_10063793 | |||
| 180 | Ga0075364_10002836 | |||
| 181 | Ga0097620_100151059 | |||
| 182 | Ga0105240_10000538 | |||
| 183 | Ga0105245_10040706 | |||
| 184 | Ga0105245_10060767 | |||
| 185 | Ga0105241_10000768 | |||
| 186 | Ga0105248_10000124 | |||
| 187 | Ga0105248_10057950 | |||
| 188 | Ga0105237_10000217 | |||
| 189 | Ga0105237_10044854 | |||
| 190 | Ga0105237_10116309 | |||
| 191 | Ga0105238_10004324 | |||
| 192 | Ga0163163_10005047 | |||
| 193 | Ga0157379_10004915 | |||
| 194 | Ga0209148_1000857 | |||
| 195 | Ga0209148_1010223 | |||
| 196 | Ga0207656_10000002 | |||
| 197 | Ga0207705_10039270 | |||
| 198 | Ga0207705_10098101 | |||
| 199 | Ga0207654_10000001 | |||
| 200 | Ga0207695_10000983 | |||
| 201 | Ga0207695_10029946 | |||
| 202 | Ga0207671_10000002 | |||
| 203 | Ga0207671_10101246 | |||
| 204 | Ga0207657_10207394 | |||
| 205 | Ga0207657_10305237 | |||
| 206 | Ga0207694_10000022 | |||
| 207 | Ga0207687_10015621 | |||
| 208 | Ga0207690_10002240 | |||
| 209 | Ga0207711_10000940 | |||
| 210 | Ga0207711_10038717 | |||
| 211 | Ga0207667_10000467 | |||
| 212 | Ga0207667_10006145 | |||
| 213 | Ga0207667_10416513 | |||
| 214 | Ga0207677_10044437 | |||
| 215 | Ga0207703_10000064 | |||
| 216 | Ga0207639_10026688 | |||
| 217 | Ga0207639_10028960 | |||
| 218 | Ga0207702_10230270 | |||
| 219 | Ga0207641_10262612 | |||
| 220 | Ga0207674_10000153 | |||
| 221 | Ga0207674_10121790 | |||
| 222 | Ga0207698_10000695 | |||
| 223 | Ga0207698_10001040 | |||
| 224 | Ga0207698_10055293 | |||
| 225 | Ga0268265_10304213 | |||
| 226 | Ga0307515_10171142 | |||
| 227 | Ga0466965_0000008 | |||
| 228 | Ga0466970_0016715 | |||
| 229 | Ga0495590_0000095 | |||
| 230 | Ga0496102_0057498 | |||
| 231 | Ga0496117_0025371 | |||
| 232 | Ga0496117_0079179 | |||
| 233 | Ga0496117_0081633 | |||
| 234 | Ga0496118_0000240 | |||
| 235 | Ga0496119_0000552 | |||
| 236 | Ga0496119_0003586 | |||
| 237 | Ga0496119_0009138 | |||
| 238 | Ga0496119_0026907 | |||
| 239 | Ga0496120_0000586 | |||
| 240 | Ga0496120_0013380 | |||
| 241 | Ga0496120_0054181 | |||
| 242 | Ga0496121_0000025 | |||
| 243 | Ga0496121_0085587 | |||
| 244 | Ga0496122_0018654 | |||
| 245 | Ga0496124_0000070 | |||
| 246 | Ga0496124_0005025 | |||
| 247 | Ga0496126_0260242 | |||
| 248 | Ga0501031_0016462 | |||
| 249 | Ga0501032_0004923 | |||
| 250 | Ga0501032_0009568 | |||
| 251 | Ga0501032_0108640 | |||
| 252 | Ga0501033_0051546 | |||
| 253 | Ga0501033_0074658 | |||
| 254 | Ga0501033_0080908 | |||
| 255 | Ga0501034_0005219 | |||
| 256 | Ga0501034_0037210 | |||
| 257 | Ga0501034_0045942 | |||
| 258 | Ga0501034_0058616 | |||
| 259 | Ga0501034_0087339 | |||
| 260 | Ga0501034_0111103 | |||
| 261 | Ga0501034_0292180 | |||
| 262 | Ga0501036_0011348 | |||
| 263 | Ga0501036_0086130 | |||
| 264 | Ga0501037_0004573 | |||
| 265 | Ga0501037_0039483 | |||
| 266 | Ga0501037_0085410 | |||
| 267 | Ga0501037_0097228 | |||
| 268 | Ga0501038_0005112 | |||
| 269 | Ga0501038_0009705 | |||
| 270 | Ga0501039_0000795 | |||
| 271 | Ga0501039_0256419 | |||
| 272 | Ga0501042_0010823 | |||
| 273 | Ga0501043_0008566 | |||
| 274 | Ga0501043_0013804 | |||
| 275 | Ga0501046_0024069 | |||
| 276 | Ga0501047_0011531 | |||
| 277 | Ga0501047_0032549 | |||
| 278 | Ga0501047_0041800 | |||
| 279 | Ga0501048_0029710 | |||
| 280 | Ga0501068_0062567 | |||
| 281 | Ga0501069_0024649 | |||
| 282 | Ga0501070_0002060 | |||
| 283 | Ga0501070_0004283 | |||
| 284 | Ga0501070_0030237 | |||
| 285 | Ga0501071_0000500 | |||
| 286 | Ga0501072_0015545 | |||
| 287 | Ga0501073_0000012 | |||
| 288 | Ga0501080_0003641 | |||
| 289 | Ga0501083_0000053 | |||
| 290 | Ga0501083_0043014 | |||
| 291 | Ga0501035_0051992 | |||
| 292 | Ga0501044_0038195 | |||
| 293 | Ga0501044_0111938 | |||
| 294 | Ga0501045_0015063 | |||
| 295 | nmdc:mga00v17_2839_c1 | |||
| 296 | Ga0500635_0001968 | |||
| 297 | Ga0500556_0000085 | |||
| 298 | Ga0500562_007429 | |||
| 299 | Ga0500593_000817 | |||
| 300 | Ga0500655_002449 | |||
| 301 | Ga0500559_0000163 | |||
| 302 | Ga0500568_0000161 | |||
| 303 | Ga0500568_0000165 | |||
| 304 | Ga0500573_0000630 | |||
| 305 | Ga0500573_0002097 | |||
| 306 | Ga0500616_0000109 | |||
| 307 | Ga0500616_0004320 | |||
| 308 | Ga0500620_000282 | |||
| 309 | 2587863830 | |||
| 310 | 2753302594 | |||
| 311 | 2857737538 | |||
| 312 | 2862994707 | |||
| 313 | 2897562202 | |||
| 314 | 2904433587 | |||
| 315 | 2904503889 | |||
| 316 | 2908676855 | |||
| 317 | 2909076958 | |||
| 318 | 2919039570 | |||
| 319 | 2919042964 | |||
| 320 | 2928105918 | |||
| 321 | 2928501997 | |||
| 322 | 2984554752 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aw8-assembly1.cif.gz_B | crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 | 0.9275 | 3 | 371 |
| 3qff-assembly1.cif.gz_B | crystal structure of adp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase | 0.9167 | 2 | 365 |
| 3aw8-assembly1.cif.gz_B | crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 | 0.9127 | 3 | 371 |
| 4ma5-assembly1.cif.gz_A-2 | the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. | 0.9117 | 1 | 371 |
| 4ma5-assembly1.cif.gz_A-2 | the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. | 0.9069 | 1 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHL9_202_394_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9657 | 182 | 368 | 3.30.470.20 |
| 3qffB03 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9321 | 176 | 365 | 3.30.470.20 |
| af_P9WHL9_202_394_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9316 | 182 | 368 | 3.30.470.20 |
| af_A0A1D6MHA0_260_452_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9291 | 178 | 364 | 3.30.470.20 |
| af_P9WHL9_13_120_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9288 | 2 | 101 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3Q9J7H3-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (EC 6.3.4.18) | 0.9746 | 243 | 370 |
GO:0005829
GO:0034028 |
| AF-A0A7W1B3U0-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) | 0.9699 | 2 | 368 |
GO:0004638
GO:0005524 GO:0005829 GO:0006189 GO:0034028 GO:0046872 |
| AF-A0A6A9UUW8-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) | 0.9693 | 2 | 368 |
GO:0004638
GO:0005524 GO:0005829 GO:0006189 GO:0034028 GO:0046872 |
| AF-A0A413RJ33-F1-model_v4 | N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) | 0.9675 | 2 | 368 |
GO:0004638
GO:0005524 GO:0005829 GO:0006189 GO:0034028 GO:0046872 |
| AF-A0A2W5CCM5-F1-model_v4 | deleted | 0.9669 | 2 | 366 |
|