F238288

General Info

Members Datasets Scaffolds Average Seq Length
162 98 324 383

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10001636|rootH1_1000163622
Length 427
Sequence MPAPPFDADSKKEIYKRIRILGFEKLSCCKIDLMKLLLVALAFVILIGSEILKVYYIMPFPGSQRDETITLAYFLNQNILYFRVAGWLLLLYSLFSTWGTMSVSIKVIIGIFFSVYLFVLILFNFYFLADKMFYQPSHKIFASASDNKVDARKLVVGVSINGESKAYPIEIIGYHHQVRDTVGGKGIMVTYCTVCRTGRVYDPTVDGRNESFRLVGMDHFNAMFEDNDTKSWWRQADGKAIVGKEKGKQLMELPSEQMTLLAWLRLHPDSKVMQPDSAYQLGYEGLQGFDNGTIGSNLEHRDSLSWKDKSWIVGIQIGKKARAYDWNELFRHRVINDTLDGTPILIALQNDSATFHVWERDTLTFSLAEAANYLIDSNTVSTWNMDGECVSGSQKGRKLPSVQSYQEFWHSWKTFHPHTTRYQKSND

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
96 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.96
Nodule 0
Rhizoplane 0
Rhizosphere 70.99
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001636 3300003323 Bacteria 76904
2 JGI24739J22299_10003879 3300001989 Bacteria 5715
3 JGI25153J46596_10042434 3300003215 Bacteria 1388
4 rootH1_10003422 3300003316 Bacteria 22736
5 rootH2_10002530 3300003320 Bacteria 24978
6 rootH2_10026715 3300003320 Bacteria 19405
7 rootL2_10007725 3300003322 Bacteria 4799
8 rootL2_10009056 3300003322 Bacteria 7045
9 rootL2_10045290 3300003322 Bacteria 4749
10 rootL2_10075792 3300003322 Bacteria 5855
11 rootL2_10120530 3300003322 Bacteria 3041
12 rootL2_10149015 3300003322 Bacteria 4137
13 rootL2_10181182 3300003322 Unclassified 2193
14 rootH1_10012305 3300003323 Bacteria 2426
15 rootH1_10024772 3300003323 Bacteria 5013
16 rootH1_10024796 3300003323 Bacteria 6122
17 rootH1_10095601 3300003323 Bacteria 3905
18 rootH1_10255422 3300003323 Bacteria 4780
19 JGI25160J50197_1001458 3300003354 Bacteria 11794
20 JGI25160J50197_1008778 3300003354 Bacteria 3818
21 Ga0055526_1032268 3300003771 Bacteria 1482
22 Ga0055528_1000698 3300003790 Bacteria 23873
23 Ga0055528_1001196 3300003790 Bacteria 16730
24 Ga0055531_10005052 3300003794 Bacteria 7820
25 Ga0065165_1000012 3300005262 Bacteria 303241
26 Ga0065165_1000505 3300005262 Bacteria 60144
27 Ga0070683_100038010 3300005329 Bacteria 4410
28 Ga0070666_10000208 3300005335 Bacteria 40242
29 Ga0070666_10096467 3300005335 Bacteria 2035
30 Ga0070680_100120174 3300005336 Bacteria 2193
31 Ga0070682_100000152 3300005337 Bacteria 54283
32 Ga0070667_100003194 3300005367 Bacteria 14042
33 Ga0070685_10119005 3300005466 Bacteria 1638
34 Ga0068853_100313364 3300005539 Bacteria 1453
35 Ga0070672_100083526 3300005543 Unclassified 2563
36 Ga0070665_100000008 3300005548 Bacteria 606341
37 Ga0068856_100054474 3300005614 Unclassified 3945
38 Ga0068852_100005244 3300005616 Bacteria 9245
39 Ga0068852_100088240 3300005616 Bacteria 2769
40 Ga0068859_100000006 3300005617 Bacteria 421509
41 Ga0068859_100009998 3300005617 Bacteria 9568
42 Ga0068859_100033856 3300005617 Bacteria 5130
43 Ga0068864_100002292 3300005618 Bacteria 15821
44 Ga0068863_100009756 3300005841 Bacteria 9363
45 Ga0068858_100000396 3300005842 Bacteria 45694
46 Ga0068860_100000029 3300005843 Bacteria 259192
47 Ga0068860_100000502 3300005843 Bacteria 48523
48 Ga0068860_100001991 3300005843 Bacteria 21550
49 Ga0068860_100003067 3300005843 Bacteria 17262
50 Ga0068860_100032682 3300005843 Bacteria 4999
51 Ga0097621_100008827 3300006237 Bacteria 7286
52 Ga0097621_100044186 3300006237 Bacteria 3594
53 Ga0068871_100004064 3300006358 Bacteria 10122
54 Ga0097620_100000006 3300006931 Bacteria 421509
55 Ga0097620_100009998 3300006931 Bacteria 9568
56 Ga0097620_100033856 3300006931 Bacteria 5130
57 Ga0105240_10002159 3300009093 Bacteria 32133
58 Ga0105240_10311940 3300009093 Bacteria 1796
59 Ga0111539_10315868 3300009094 Unclassified 1818
60 Ga0105247_10003209 3300009101 Bacteria 10774
61 Ga0105241_10004686 3300009174 Bacteria 10099
62 Ga0105237_10000171 3300009545 Bacteria 90778
63 Ga0105237_10000474 3300009545 Bacteria 57006
64 Ga0105237_10002941 3300009545 Bacteria 20624
65 Ga0105237_10004722 3300009545 Bacteria 15671
66 Ga0105239_10004967 3300010375 Bacteria 15708
67 Ga0105239_10015504 3300010375 Bacteria 8440
68 Ga0105239_10024847 3300010375 Bacteria 6599
69 Ga0105239_10056134 3300010375 Bacteria 4319
70 Ga0105246_10009305 3300011119 Bacteria 6050
71 Ga0157373_10184382 3300013100 Bacteria 1470
72 Ga0157371_10051253 3300013102 Bacteria 2933
73 Ga0157374_10061471 3300013296 Bacteria 3518
74 Ga0157374_10162988 3300013296 Bacteria 2172
75 Ga0157374_10334801 3300013296 Bacteria 1502
76 Ga0157378_10001999 3300013297 Bacteria 18236
77 Ga0157378_10007921 3300013297 Bacteria 9270
78 Ga0157378_10008669 3300013297 Bacteria 8850
79 Ga0157378_10101014 3300013297 Unclassified 2634
80 Ga0157378_10127373 3300013297 Bacteria 2353
81 Ga0157378_10204243 3300013297 Unclassified 1870
82 Ga0163162_10000038 3300013306 Bacteria 138065
83 Ga0163162_10000519 3300013306 Bacteria 35771
84 Ga0163162_10022858 3300013306 Bacteria 6165
85 Ga0157372_10138094 3300013307 Bacteria 2808
86 Ga0157372_10228868 3300013307 Bacteria 2155
87 Ga0157372_10260594 3300013307 Bacteria 2013
88 Ga0157372_10285331 3300013307 Bacteria 1920
89 Ga0157380_10069074 3300014326 Bacteria 2850
90 Ga0157376_10004296 3300014969 Bacteria 9899
91 Ga0157376_10065274 3300014969 Bacteria 3073
92 Ga0157376_10094551 3300014969 Bacteria 2597
93 Ga0213876_10008685 3300021384 Bacteria 5496
94 Ga0209673_1000016 3300025273 Bacteria 506202
95 Ga0209673_1000111 3300025273 Bacteria 180094
96 Ga0209564_1009974 3300025295 Bacteria 4438
97 Ga0209564_1014573 3300025295 Bacteria 3260
98 Ga0209758_1003887 3300025297 Bacteria 13070
99 Ga0209758_1009602 3300025297 Bacteria 5974
100 Ga0209050_1000444 3300025298 Bacteria 74945
101 Ga0207426_1000241 3300025302 Bacteria 122857
102 Ga0207426_1000606 3300025302 Bacteria 46465
103 Ga0209257_1000005 3300025304 Bacteria 1592528
104 Ga0209257_1002226 3300025304 Bacteria 19949
105 Ga0207680_10000072 3300025903 Bacteria 44683
106 Ga0207680_10076714 3300025903 Bacteria 2088
107 Ga0207654_10001964 3300025911 Bacteria 10651
108 Ga0207695_10386689 3300025913 Bacteria 1284
109 Ga0207671_10003558 3300025914 Bacteria 15439
110 Ga0207671_10010219 3300025914 Bacteria 7768
111 Ga0207671_10192208 3300025914 Bacteria 1592
112 Ga0207644_10191801 3300025931 Unclassified 1607
113 Ga0207706_10367466 3300025933 Bacteria 1249
114 Ga0207691_10130309 3300025940 Unclassified 2222
115 Ga0207689_10000383 3300025942 Bacteria 41569
116 Ga0207651_10277564 3300025960 Bacteria 1383
117 Ga0207640_10263710 3300025981 Bacteria 1344
118 Ga0207658_10008471 3300025986 Bacteria 6996
119 Ga0207658_10067940 3300025986 Bacteria 2687
120 Ga0207677_10087993 3300026023 Bacteria 2251
121 Ga0207703_10005846 3300026035 Bacteria 9852
122 Ga0207702_10051934 3300026078 Unclassified 3467
123 Ga0207641_10000280 3300026088 Bacteria 64281
124 Ga0207698_10070869 3300026142 Bacteria 2763
125 Ga0268266_10000016 3300028379 Bacteria 629101
126 Ga0268264_10000072 3300028381 Bacteria 260791
127 Ga0268264_10002679 3300028381 Bacteria 15543
128 Ga0268264_10004703 3300028381 Bacteria 11599
129 Ga0268264_10011245 3300028381 Bacteria 7396
130 Ga0268264_10013829 3300028381 Bacteria 6639
131 Ga0307517_10090716 3300028786 Bacteria 2504
132 Ga0307515_10000021 3300028794 Bacteria 406008
133 Ga0307515_10000394 3300028794 Bacteria 105754
134 Ga0307515_10244088 3300028794 Bacteria 1561
135 Ga0307511_10000650 3300030521 Bacteria 37078
136 Ga0307509_10112516 3300031507 Unclassified 2722
137 Ga0307516_10007608 3300031730 Bacteria 12416
138 Ga0307414_10295253 3300032004 Bacteria 1368
139 Ga0373937_0494490 3300036401 Unclassified 1162
140 Ga0436365_0738408 3300039437 Bacteria 10003
141 Ga0436365_0920295 3300039437 Bacteria 45426
142 Ga0451577_0040162 3300042876 Unclassified 4202
143 Ga0451576_0022420 3300045051 Bacteria 6847
144 Ga0451576_0219594 3300045051 Bacteria 1985
145 Ga0495638_0057437 3300046460 Bacteria 2413
146 Ga0495580_0249752 3300046472 Bacteria 1215
147 Ga0495643_0037008 3300046522 Unclassified 2679
148 Ga0495611_0000084 3300046648 Bacteria 66870
149 Ga0495687_000004 3300047443 Bacteria 779298
150 Ga0495686_0002430 3300047472 Bacteria 17597
151 Ga0501034_0125675 3300049571 Bacteria 2550
152 Ga0501070_0008512 3300049586 Bacteria 8671
153 Ga0501072_0181756 3300049588 Bacteria 1678
154 Ga0501073_0012114 3300049589 Bacteria 6297
155 Ga0501074_0153820 3300049590 Bacteria 1644
156 Ga0501236_000470 3300049670 Bacteria 4568
157 Ga0501079_0175186 3300049741 Bacteria 1673
158 Ga0501083_0013031 3300049744 Bacteria 5808
159 Ga0501264_000078 3300049761 Bacteria 14014
160 Ga0500583_0000327 3300053092 Bacteria 15991
161 Ga0501084_0040148 3300054114 Bacteria 3914
162 Ga0501082_0014191 3300060353 Bacteria 6857
163 rootH1_10001636
164 JGI24739J22299_10003879
165 JGI25153J46596_10042434
166 rootH1_10003422
167 rootH2_10002530
168 rootH2_10026715
169 rootL2_10007725
170 rootL2_10009056
171 rootL2_10045290
172 rootL2_10075792
173 rootL2_10120530
174 rootL2_10149015
175 rootL2_10181182
176 rootH1_10012305
177 rootH1_10024772
178 rootH1_10024796
179 rootH1_10095601
180 rootH1_10255422
181 JGI25160J50197_1001458
182 JGI25160J50197_1008778
183 Ga0055526_1032268
184 Ga0055528_1000698
185 Ga0055528_1001196
186 Ga0055531_10005052
187 Ga0065165_1000012
188 Ga0065165_1000505
189 Ga0070683_100038010
190 Ga0070666_10000208
191 Ga0070666_10096467
192 Ga0070680_100120174
193 Ga0070682_100000152
194 Ga0070667_100003194
195 Ga0070685_10119005
196 Ga0068853_100313364
197 Ga0070672_100083526
198 Ga0070665_100000008
199 Ga0068856_100054474
200 Ga0068852_100005244
201 Ga0068852_100088240
202 Ga0068859_100000006
203 Ga0068859_100009998
204 Ga0068859_100033856
205 Ga0068864_100002292
206 Ga0068863_100009756
207 Ga0068858_100000396
208 Ga0068860_100000029
209 Ga0068860_100000502
210 Ga0068860_100001991
211 Ga0068860_100003067
212 Ga0068860_100032682
213 Ga0097621_100008827
214 Ga0097621_100044186
215 Ga0068871_100004064
216 Ga0097620_100000006
217 Ga0097620_100009998
218 Ga0097620_100033856
219 Ga0105240_10002159
220 Ga0105240_10311940
221 Ga0111539_10315868
222 Ga0105247_10003209
223 Ga0105241_10004686
224 Ga0105237_10000171
225 Ga0105237_10000474
226 Ga0105237_10002941
227 Ga0105237_10004722
228 Ga0105239_10004967
229 Ga0105239_10015504
230 Ga0105239_10024847
231 Ga0105239_10056134
232 Ga0105246_10009305
233 Ga0157373_10184382
234 Ga0157371_10051253
235 Ga0157374_10061471
236 Ga0157374_10162988
237 Ga0157374_10334801
238 Ga0157378_10001999
239 Ga0157378_10007921
240 Ga0157378_10008669
241 Ga0157378_10101014
242 Ga0157378_10127373
243 Ga0157378_10204243
244 Ga0163162_10000038
245 Ga0163162_10000519
246 Ga0163162_10022858
247 Ga0157372_10138094
248 Ga0157372_10228868
249 Ga0157372_10260594
250 Ga0157372_10285331
251 Ga0157380_10069074
252 Ga0157376_10004296
253 Ga0157376_10065274
254 Ga0157376_10094551
255 Ga0213876_10008685
256 Ga0209673_1000016
257 Ga0209673_1000111
258 Ga0209564_1009974
259 Ga0209564_1014573
260 Ga0209758_1003887
261 Ga0209758_1009602
262 Ga0209050_1000444
263 Ga0207426_1000241
264 Ga0207426_1000606
265 Ga0209257_1000005
266 Ga0209257_1002226
267 Ga0207680_10000072
268 Ga0207680_10076714
269 Ga0207654_10001964
270 Ga0207695_10386689
271 Ga0207671_10003558
272 Ga0207671_10010219
273 Ga0207671_10192208
274 Ga0207644_10191801
275 Ga0207706_10367466
276 Ga0207691_10130309
277 Ga0207689_10000383
278 Ga0207651_10277564
279 Ga0207640_10263710
280 Ga0207658_10008471
281 Ga0207658_10067940
282 Ga0207677_10087993
283 Ga0207703_10005846
284 Ga0207702_10051934
285 Ga0207641_10000280
286 Ga0207698_10070869
287 Ga0268266_10000016
288 Ga0268264_10000072
289 Ga0268264_10002679
290 Ga0268264_10004703
291 Ga0268264_10011245
292 Ga0268264_10013829
293 Ga0307517_10090716
294 Ga0307515_10000021
295 Ga0307515_10000394
296 Ga0307515_10244088
297 Ga0307511_10000650
298 Ga0307509_10112516
299 Ga0307516_10007608
300 Ga0307414_10295253
301 Ga0373937_0494490
302 Ga0436365_0738408
303 Ga0436365_0920295
304 Ga0451577_0040162
305 Ga0451576_0022420
306 Ga0451576_0219594
307 Ga0495638_0057437
308 Ga0495580_0249752
309 Ga0495643_0037008
310 Ga0495611_0000084
311 Ga0495687_000004
312 Ga0495686_0002430
313 Ga0501034_0125675
314 Ga0501070_0008512
315 Ga0501072_0181756
316 Ga0501073_0012114
317 Ga0501074_0153820
318 Ga0501236_000470
319 Ga0501079_0175186
320 Ga0501083_0013031
321 Ga0501264_000078
322 Ga0500583_0000327
323 Ga0501084_0040148
324 Ga0501082_0014191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11376

DUF3179

Protein of unknown function (DUF3179)

135

419

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.7342 294 376
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.7274 299 377
4nbf-assembly1.cif.gz_C oxygenase with gln282 replaced by asn and ferredoxin complex of carbazole 1,9a-dioxygenase 0.6878 301 378
5vgc-assembly1.cif.gz_B crystal structure of the nleg5-1 effector (c200a) from escherichia coli o157:h7 str. sakai 0.6734 294 332
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.6677 277 376
ID Description Score Start End Superfamily
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7342 294 376 2.102.10.10
af_I1JZ61_209_331_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7249 293 377 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.6677 277 376 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.6631 143 219 2.102.10.10
af_Q1L8U8_722_786_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6586 171 201 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A7Y4XL50-F1-model_v4 DUF3179 domain-containing protein 0.9924 1 393 GO:0016020
AF-A0A5J5IEH3-F1-model_v4 DUF3179 domain-containing protein 0.9916 1 389 GO:0016020
AF-A0A4Q3N2L6-F1-model_v4 DUF3179 domain-containing protein 0.9905 135 391
AF-A0A7Y4XL50-F1-model_v4 DUF3179 domain-containing protein 0.9898 1 393 GO:0016020
AF-A0A1S2VMK5-F1-model_v4 DUF3179 domain-containing protein 0.9876 1 392 GO:0016020

Map