F238341

General Info

Members Datasets Scaffolds Average Seq Length
162 122 324 417

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10104348|Ga0065704_101043482
Length 437
Sequence MYPVGDFPNSTFAALNKSDMTIDFEKASFKDFEDIAGIDPFGRASLFNDYSIYKRERGQMNYRQLAISGCGPEITLKIPGIPINRFVSLVSNDYLGFTQHPEVKAAAIAAIEKYGSGVGASPAIGGHMDFHEALEQKIAGFFQRESAIIYTTGYTSNSATLQCLLRKSDLAILDQAVHASVYEGCQLSNVKSFPHNNLHALERILAASQTKYRTRMVIVDGVYSQDGDLAPLKEIVELCKRYGAYSVVDDAHGTGVIGKTGRGVIELNDLFQEVDLITGTFSKTFAHIGGYVVARPELINFLKFQSRQHLFSASSTPAAACILKAIDLVDQEPHWMDQLREKTEYLRSGLRNLGLNTGISQSAIIPVKIGDITRNAEVCRLLLEAGVYANQINYPAVSRKDARIRMSVMATHSYEHLDEVLNAWEWVVTKSKIVNFE

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
35 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
55 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
56 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
57 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
69 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
76 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
79 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
80 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
81 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
82 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
83 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
84 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
85 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
86 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
87 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
88 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
89 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
90 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
91 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
92 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
93 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
94 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
95 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
96 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
97 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
98 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
99 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
100 2738543023 Pedobacter sp. OK628 Isolate Unclassified
101 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
102 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
103 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
104 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
105 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
106 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
107 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
108 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
109 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
110 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
111 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
112 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
113 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
114 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
115 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
116 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
117 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
118 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
119 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
120 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
121 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
122 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 74.69
Metatranscriptomes 0.62
Isolates 24.69

Biome Distribution

Category Percentage (%)
Aerial Root 1.23
Bulb 0
Endosphere 3.09
Nodule 0.62
Rhizoplane 1.23
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10104348 3300005289 Unclassified 2144
2 SwRhRL2b_contig_3327501 2162886007 Bacteria 1128
3 JGI24739J22299_10003521 3300001989 Bacteria 5979
4 JGI24735J21928_10000005 3300002067 Bacteria 356755
5 JGI25162J39368_1000005 3300002737 Bacteria 435925
6 rootH1_10172485 3300003316 Bacteria 3341
7 rootH2_10001891 3300003320 Bacteria 464318
8 rootH2_10024944 3300003320 Bacteria 5261
9 rootH2_10119194 3300003320 Bacteria 8380
10 rootL2_10119766 3300003322 Bacteria 3696
11 rootL2_10158102 3300003322 Bacteria 9744
12 rootL2_10285716 3300003322 Bacteria 2319
13 rootH1_10000566 3300003316 Bacteria 33162
14 rootH1_10000566 3300003323 Bacteria 205679
15 rootH1_10069386 3300003316 Bacteria 2877
16 rootH1_10069386 3300003323 Bacteria 8097
17 rootH1_10114741 3300003323 Bacteria 6362
18 rootH1_10236592 3300003323 Viruses 2046
19 Ga0006562J51391_1002321 3300003578 Bacteria 2482
20 Ga0065714_10064593 3300005288 Bacteria 30901
21 Ga0065714_10092670 3300005288 Bacteria 1868
22 Ga0065704_10073437 3300005289 Bacteria 7162
23 Ga0065704_10074942 3300005289 Bacteria 5870
24 Ga0068855_100000222 3300005563 Bacteria 72681
25 Ga0068856_100000005 3300005614 Bacteria 225505
26 Ga0068856_100000021 3300005614 Bacteria 145017
27 Ga0097621_100000235 3300006237 Bacteria 37163
28 Ga0068871_100013030 3300006358 Bacteria 6162
29 Ga0105244_10000080 3300009036 Bacteria 106764
30 Ga0105240_10000221 3300009093 Bacteria 114656
31 Ga0105243_10000007 3300009148 Bacteria 445042
32 Ga0105248_10288752 3300009177 Bacteria 1847
33 Ga0105237_10000693 3300009545 Bacteria 46571
34 Ga0105237_10289550 3300009545 Unclassified 1641
35 Ga0105238_10016851 3300009551 Bacteria 7412
36 Ga0105239_10000005 3300010375 Bacteria 496066
37 Ga0105239_10000053 3300010375 Bacteria 163705
38 Ga0105239_10000738 3300010375 Bacteria 46490
39 Ga0157373_10000048 3300013100 Bacteria 110104
40 Ga0157373_10000053 3300013100 Bacteria 104200
41 Ga0157371_10042207 3300013102 Unclassified 3251
42 Ga0157370_10000205 3300013104 Bacteria 74877
43 Ga0157370_10029150 3300013104 Bacteria 5421
44 Ga0157369_10111416 3300013105 Bacteria 2908
45 Ga0163162_10015333 3300013306 Bacteria 7488
46 Ga0163162_10085161 3300013306 Bacteria 3237
47 Ga0157372_10000326 3300013307 Bacteria 52158
48 Ga0157375_10003611 3300013308 Bacteria 13422
49 Ga0182008_10000030 3300014497 Bacteria 169168
50 Ga0182008_10002274 3300014497 Bacteria 12124
51 Ga0182006_1000011 3300015261 Bacteria 408647
52 Ga0182007_10000023 3300015262 Bacteria 187131
53 Ga0209437_100043 3300025233 Bacteria 440454
54 Ga0209026_1000238 3300025250 Bacteria 71772
55 Ga0209675_1000056 3300025291 Bacteria 187664
56 Ga0207655_1001862 3300025728 Bacteria 18200
57 Ga0207695_10000189 3300025913 Bacteria 177142
58 Ga0207671_10000624 3300025914 Bacteria 46503
59 Ga0207671_10150736 3300025914 Bacteria 1796
60 Ga0207694_10000244 3300025924 Bacteria 52258
61 Ga0207709_10000033 3300025935 Bacteria 320483
62 Ga0207711_10196114 3300025941 Bacteria 1842
63 Ga0207667_10028222 3300025949 Bacteria 6098
64 Ga0207702_10000047 3300026078 Bacteria 143192
65 Ga0207702_10000515 3300026078 Bacteria 43571
66 Ga0307515_10179158 3300028794 Bacteria 2077
67 Ga0265338_10000563 3300028800 Bacteria 65172
68 Ga0307407_10000040 3300031903 Bacteria 66966
69 Ga0307412_10000012 3300031911 Bacteria 404180
70 Ga0307412_10000063 3300031911 Bacteria 125959
71 Ga0307412_10001689 3300031911 Bacteria 12204
72 Ga0307412_10003616 3300031911 Bacteria 8590
73 Ga0307416_100000033 3300032002 Bacteria 156736
74 Ga0307414_10000923 3300032004 Bacteria 15036
75 Ga0307414_10027540 3300032004 Bacteria 3675
76 Ga0307414_10043630 3300032004 Bacteria 3056
77 Ga0307414_10091138 3300032004 Bacteria 2265
78 Ga0395899_0000001 3300037312 Bacteria 1750322
79 Ga0395899_0000027 3300037312 Bacteria 337387
80 Ga0395900_0111506 3300037418 Bacteria 2810
81 Ga0395905_0000769 3300037471 Bacteria 42306
82 Ga0395901_0002005 3300038443 Bacteria 20948
83 Ga0439465_0006798 3300041413 Bacteria 3635
84 Ga0439445_0000767 3300042004 Bacteria 6741
85 Ga0495627_000003 3300046453 Bacteria 704557
86 Ga0495627_016389 3300046453 Bacteria 2537
87 Ga0495596_0003715 3300046500 Bacteria 7627
88 Ga0495606_0016900 3300046507 Bacteria 5540
89 Ga0495610_0000001 3300046512 Bacteria 1620061
90 Ga0495632_0003666 3300046519 Bacteria 10774
91 Ga0495643_0013277 3300046522 Bacteria 4935
92 Ga0495654_0000001 3300046530 Bacteria 1513197
93 Ga0495633_0000007 3300046558 Bacteria 317976
94 Ga0495625_0001118 3300046660 Bacteria 34697
95 Ga0495625_0001255 3300046660 Bacteria 32025
96 Ga0495625_0007526 3300046660 Bacteria 9460
97 Ga0495661_0052751 3300046665 Bacteria 2448
98 Ga0495686_0000398 3300047472 Bacteria 68969
99 Ga0495686_0009612 3300047472 Bacteria 6946
100 Ga0495686_0015609 3300047472 Bacteria 5181
101 Ga0496102_0159622 3300048905 Bacteria 2120
102 Ga0496115_0018248 3300048918 Bacteria 5383
103 Ga0496116_0000012 3300048919 Bacteria 611365
104 Ga0496117_0000257 3300048920 Bacteria 99879
105 Ga0496118_0000196 3300048921 Bacteria 106933
106 Ga0496119_0000002 3300048922 Bacteria 738385
107 Ga0496121_0112467 3300048924 Bacteria 2074
108 Ga0496122_0000633 3300048925 Bacteria 71586
109 Ga0496122_0000848 3300048925 Bacteria 57604
110 Ga0496122_0000950 3300048925 Bacteria 52444
111 Ga0496122_0003496 3300048925 Bacteria 20642
112 Ga0496122_0011585 3300048925 Bacteria 8901
113 Ga0496124_0022799 3300048927 Bacteria 5732
114 Ga0496125_0000878 3300048928 Bacteria 47703
115 Ga0496125_0008111 3300048928 Bacteria 11061
116 Ga0496125_0025850 3300048928 Bacteria 5365
117 Ga0496126_0000114 3300048929 Bacteria 188605
118 Ga0501251_001753 3300049681 Bacteria 2040
119 Ga0501241_000005 3300049758 Bacteria 176449
120 Ga0501241_010921 3300049758 Unclassified 1650
121 Ga0501269_000012 3300049766 Bacteria 61214
122 Ga0500608_032961 3300053122 Bacteria 2464
123 Ga0500618_000472 3300053125 Bacteria 26098
124 2511234162 2511231000 Bacteria 4488346
125 2585142662 2582581278 Bacteria 5296881
126 2585156936 2582581281 Bacteria 4487904
127 2585161169 2582581282 Bacteria 4495830
128 2586210537 2585427687 Bacteria 5544917
129 2587678463 2585428045 Bacteria 5203023
130 2587750167 2585428060 Bacteria 5304711
131 2587943139 2585428115 Bacteria 4420269
132 2588208569 2585428182 Bacteria 5007281
133 2588212938 2585428183 Bacteria 5166119
134 2588219528 2585428184 Bacteria 4978681
135 2588224161 2585428185 Bacteria 4969476
136 2588233674 2585428187 Bacteria 4629388
137 2588446209 2588253712 Bacteria 5403181
138 2590600502 2588254255 Bacteria 5014294
139 2590611751 2588254257 Bacteria 5436094
140 2729201731 2728369107 Bacteria 5082720
141 2739303665 2738543023 Bacteria 6767879
142 2740057395 2739367874 Bacteria 4872888
143 2753672920 2751185877 Bacteria 4921427
144 2765572308 2765235839 Bacteria 5314748
145 2772605155 2772190705 Bacteria 4666226
146 2775673090 2775506739 Bacteria 3855222
147 2816872583 2816332188 Bacteria 5133218
148 2842083990 2842083920 Bacteria 4857652
149 2852625897 2852623160 Bacteria 4376875
150 2871722919 2871720351 Bacteria 4862476
151 2889292056 2889290771 Bacteria 5530962
152 2896346738 2896344016 Bacteria 3811746
153 2906003022 2905999023 Bacteria 4591259
154 2919097175 2919097161 Bacteria 3860339
155 2919402692 2919399522 Bacteria 5164947
156 2945927532 2945924605 Bacteria 4296724
157 2946021185 2946019816 Bacteria 4621265
158 2977246347 2977243572 Bacteria 4374394
159 2984575743 2984572630 Bacteria 4186940
160 2984609198 2984606641 Bacteria 4186971
161 2993373612 2993372514 Bacteria 4214139
162 2993484285 2993480792 Bacteria 4022225
163 3003234189 3003233435 Bacteria 4458031
164 Ga0065704_10104348
165 SwRhRL2b_contig_3327501
166 JGI24739J22299_10003521
167 JGI24735J21928_10000005
168 JGI25162J39368_1000005
169 rootH1_10172485
170 rootH2_10001891
171 rootH2_10024944
172 rootH2_10119194
173 rootL2_10119766
174 rootL2_10158102
175 rootL2_10285716
176 rootH1_10000566
177 rootH1_10069386
178 rootH1_10114741
179 rootH1_10236592
180 Ga0006562J51391_1002321
181 Ga0065714_10064593
182 Ga0065714_10092670
183 Ga0065704_10073437
184 Ga0065704_10074942
185 Ga0068855_100000222
186 Ga0068856_100000005
187 Ga0068856_100000021
188 Ga0097621_100000235
189 Ga0068871_100013030
190 Ga0105244_10000080
191 Ga0105240_10000221
192 Ga0105243_10000007
193 Ga0105248_10288752
194 Ga0105237_10000693
195 Ga0105237_10289550
196 Ga0105238_10016851
197 Ga0105239_10000005
198 Ga0105239_10000053
199 Ga0105239_10000738
200 Ga0157373_10000048
201 Ga0157373_10000053
202 Ga0157371_10042207
203 Ga0157370_10000205
204 Ga0157370_10029150
205 Ga0157369_10111416
206 Ga0163162_10015333
207 Ga0163162_10085161
208 Ga0157372_10000326
209 Ga0157375_10003611
210 Ga0182008_10000030
211 Ga0182008_10002274
212 Ga0182006_1000011
213 Ga0182007_10000023
214 Ga0209437_100043
215 Ga0209026_1000238
216 Ga0209675_1000056
217 Ga0207655_1001862
218 Ga0207695_10000189
219 Ga0207671_10000624
220 Ga0207671_10150736
221 Ga0207694_10000244
222 Ga0207709_10000033
223 Ga0207711_10196114
224 Ga0207667_10028222
225 Ga0207702_10000047
226 Ga0207702_10000515
227 Ga0307515_10179158
228 Ga0265338_10000563
229 Ga0307407_10000040
230 Ga0307412_10000012
231 Ga0307412_10000063
232 Ga0307412_10001689
233 Ga0307412_10003616
234 Ga0307416_100000033
235 Ga0307414_10000923
236 Ga0307414_10027540
237 Ga0307414_10043630
238 Ga0307414_10091138
239 Ga0395899_0000001
240 Ga0395899_0000027
241 Ga0395900_0111506
242 Ga0395905_0000769
243 Ga0395901_0002005
244 Ga0439465_0006798
245 Ga0439445_0000767
246 Ga0495627_000003
247 Ga0495627_016389
248 Ga0495596_0003715
249 Ga0495606_0016900
250 Ga0495610_0000001
251 Ga0495632_0003666
252 Ga0495643_0013277
253 Ga0495654_0000001
254 Ga0495633_0000007
255 Ga0495625_0001118
256 Ga0495625_0001255
257 Ga0495625_0007526
258 Ga0495661_0052751
259 Ga0495686_0000398
260 Ga0495686_0009612
261 Ga0495686_0015609
262 Ga0496102_0159622
263 Ga0496115_0018248
264 Ga0496116_0000012
265 Ga0496117_0000257
266 Ga0496118_0000196
267 Ga0496119_0000002
268 Ga0496121_0112467
269 Ga0496122_0000633
270 Ga0496122_0000848
271 Ga0496122_0000950
272 Ga0496122_0003496
273 Ga0496122_0011585
274 Ga0496124_0022799
275 Ga0496125_0000878
276 Ga0496125_0008111
277 Ga0496125_0025850
278 Ga0496126_0000114
279 Ga0501251_001753
280 Ga0501241_000005
281 Ga0501241_010921
282 Ga0501269_000012
283 Ga0500608_032961
284 Ga0500618_000472
285 2511234162
286 2585142662
287 2585156936
288 2585161169
289 2586210537
290 2587678463
291 2587750167
292 2587943139
293 2588208569
294 2588212938
295 2588219528
296 2588224161
297 2588233674
298 2588446209
299 2590600502
300 2590611751
301 2729201731
302 2739303665
303 2740057395
304 2753672920
305 2765572308
306 2772605155
307 2775673090
308 2816872583
309 2842083990
310 2852625897
311 2871722919
312 2889292056
313 2896346738
314 2906003022
315 2919097175
316 2919402692
317 2945927532
318 2946021185
319 2977246347
320 2984575743
321 2984609198
322 2993373612
323 2993484285
324 3003234189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

84

423

0.92

PF00266

Aminotran_5

Aminotransferase class-V

93

258

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bxp-assembly1.cif.gz_B 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 0.9573 2 346
4bmk-assembly1.cif.gz_A serine palmitoyltransferase k265a from s. paucimobilis with bound plp- myriocin aldimine 0.9566 2 346
8guh-assembly1.cif.gz_A serine palmitoyltransferase from sphingobacterium multivorum complexed with tris 0.9545 2 342
7v5i-assembly1.cif.gz_B structural insights into the substrate selectivity of acyl-coa transferase 0.9539 2 342
1fc4-assembly1.cif.gz_B 2-amino-3-ketobutyrate coa ligase 0.953 2 345
ID Description Score Start End Superfamily
af_I1JW06_395_456_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9757 275 335 3.90.1150.10
af_Q2G0M8_295_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9749 248 342 3.90.1150.10
3a2bA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9686 250 342 3.90.1150.10
af_Q4CT40_69_162_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9639 250 336 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9595 249 333 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A292PHR7-F1-model_v4 HTH tetR-type domain-containing protein 0.9827 1 350 GO:0003677
GO:0009058
GO:0030170
AF-A0A401LZ32-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9818 115 346 GO:0009058
GO:0016740
GO:0030170
AF-A0A3D2WWS6-F1-model_v4 8-amino-7-oxononanoate synthase 0.9816 245 346 GO:0009058
GO:0030170
AF-A0A381TWV1-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9789 256 342 GO:0009058
GO:0030170
AF-A0A069SC15-F1-model_v4 deleted 0.9776 1 246

Map