F239134

General Info

Members Datasets Scaffolds Average Seq Length
162 118 324 450

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10166131|Ga0111539_101661312
Length 487
Sequence VLHRPSRAASRPAQMPPPRRSDETQLRSSGTLAEQQVSMTKRLFIKTYGCQMNVYDSARMAELMAPLGYAQAERPDGADLVILNTCHIREKAAEKVFSELGTIRRLKEAKRKHGGRMVVAVAGCVAQAEGAEILERAPFVDLVFGPQSYHRLPEMVARAADGSREGILDTSFPAEPKFDFLPLTTAAPGVSAFLTVQEGCDKFCTFCVVPYTRGAEYSRPATDVLAEAERLAAAGARELTLLGQNVNAYHGAAPDGGEWRLGELIGALAKTPGLERLRYTTSHPRDVDDGLIAAHRDVPQLMPFLHLPVQSGSDRVLAAMKRRHTADHYRRTVDRLRAARTDLALSSDFIVGYPGETDADFAATLDLVREIGFAQAFSFKYSPRPGTPAASAADQVPESVKSERLATLQHLLQRQQRDFSRACVGQVLPVLFEKPGRHAGQLVGRSPYLQSVHIEGGPYRIGDIVPVLIERAEPNSLAGTAAPEHRT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
116 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
117 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
118 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 1.23
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10166131 3300009094 Bacteria 2580
2 Ga0070658_10102715 3300005327 Bacteria 2364
3 Ga0070676_10005828 3300005328 Bacteria 6571
4 Ga0070668_100005886 3300005347 Bacteria 9091
5 Ga0070659_100051224 3300005366 Bacteria 3246
6 Ga0070667_100245792 3300005367 Bacteria 1599
7 Ga0070714_100158215 3300005435 Bacteria 2047
8 Ga0070713_100004150 3300005436 Bacteria 9661
9 Ga0070713_100027648 3300005436 Bacteria 4467
10 Ga0070713_100063525 3300005436 Bacteria 3096
11 Ga0070713_100148793 3300005436 Bacteria 2081
12 Ga0070713_100169085 3300005436 Bacteria 1957
13 Ga0070710_10002330 3300005437 Bacteria 8990
14 Ga0070711_100011301 3300005439 Bacteria 5540
15 Ga0070711_100011753 3300005439 Bacteria 5444
16 Ga0070678_100056968 3300005456 Bacteria 2861
17 Ga0070681_10000614 3300005458 Bacteria 29218
18 Ga0070681_10043588 3300005458 Bacteria 4493
19 Ga0070706_100037492 3300005467 Bacteria 4477
20 Ga0070698_100006435 3300005471 Bacteria 12736
21 Ga0070698_100182799 3300005471 Bacteria 2035
22 Ga0070679_100000410 3300005530 Bacteria 36467
23 Ga0070684_100042146 3300005535 Bacteria 3940
24 Ga0070665_100024861 3300005548 Bacteria 6035
25 Ga0070704_100010003 3300005549 Bacteria 5761
26 Ga0068856_100015466 3300005614 Bacteria 7373
27 Ga0068860_100001901 3300005843 Bacteria 22162
28 Ga0070717_10007628 3300006028 Bacteria 8041
29 Ga0070712_100004127 3300006175 Bacteria 8927
30 Ga0068871_100206475 3300006358 Bacteria 1698
31 Ga0075428_100224545 3300006844 Bacteria 2028
32 Ga0075436_100014009 3300006914 Bacteria 5487
33 Ga0075435_100030327 3300007076 Bacteria 4250
34 Ga0099795_10000291 3300007788 Bacteria 8993
35 Ga0099795_10001848 3300007788 Bacteria 4780
36 Ga0099795_10007906 3300007788 Bacteria 3000
37 Ga0105240_10064934 3300009093 Bacteria 4533
38 Ga0105240_10079056 3300009093 Bacteria 4049
39 Ga0105245_10167704 3300009098 Bacteria 2088
40 Ga0105243_10018988 3300009148 Bacteria 5212
41 Ga0105242_10007600 3300009176 Bacteria 8341
42 Ga0099796_10000321 3300010159 Bacteria 7697
43 Ga0157370_10000971 3300013104 Bacteria 36295
44 Ga0157370_10004453 3300013104 Bacteria 16057
45 Ga0157372_10001838 3300013307 Bacteria 23006
46 Ga0157372_10024997 3300013307 Bacteria 6490
47 Ga0157372_10190503 3300013307 Bacteria 2376
48 Ga0157377_10044253 3300014745 Bacteria 2481
49 Ga0157379_10001360 3300014968 Bacteria 20024
50 Ga0213874_10000767 3300021377 Bacteria 6522
51 Ga0213875_10000081 3300021388 Bacteria 114181
52 Ga0213875_10008671 3300021388 Bacteria 5191
53 Ga0213875_10035689 3300021388 Bacteria 2346
54 Ga0209563_101834 3300025230 Bacteria 5229
55 Ga0209676_1000197 3300025292 Bacteria 135043
56 Ga0209050_1018758 3300025298 Bacteria 2667
57 Ga0207645_10011026 3300025907 Bacteria 6185
58 Ga0207705_10084586 3300025909 Bacteria 2316
59 Ga0207684_10075857 3300025910 Bacteria 2857
60 Ga0207684_10087450 3300025910 Bacteria 2655
61 Ga0207707_10001175 3300025912 Bacteria 24645
62 Ga0207707_10092699 3300025912 Bacteria 2639
63 Ga0207693_10001699 3300025915 Bacteria 19392
64 Ga0207693_10061204 3300025915 Bacteria 2948
65 Ga0207693_10067523 3300025915 Bacteria 2800
66 Ga0207663_10008022 3300025916 Bacteria 5505
67 Ga0207663_10045728 3300025916 Bacteria 2694
68 Ga0207663_10129099 3300025916 Bacteria 1743
69 Ga0207652_10002885 3300025921 Bacteria 14366
70 Ga0207646_10008878 3300025922 Bacteria 10011
71 Ga0207694_10035169 3300025924 Bacteria 3842
72 Ga0207659_10024725 3300025926 Bacteria 4029
73 Ga0207700_10077507 3300025928 Bacteria 2582
74 Ga0207700_10207452 3300025928 Bacteria 1655
75 Ga0207664_10022549 3300025929 Bacteria 4704
76 Ga0207664_10056646 3300025929 Bacteria 3113
77 Ga0207664_10124397 3300025929 Bacteria 2163
78 Ga0207690_10030336 3300025932 Bacteria 3448
79 Ga0207709_10010059 3300025935 Bacteria 5212
80 Ga0207669_10079482 3300025937 Bacteria 2094
81 Ga0207689_10059782 3300025942 Bacteria 3134
82 Ga0207668_10120003 3300025972 Bacteria 1989
83 Ga0207702_10030791 3300026078 Bacteria 4470
84 Ga0207702_10060539 3300026078 Bacteria 3228
85 Ga0207648_10059609 3300026089 Bacteria 3329
86 Ga0207674_10229199 3300026116 Bacteria 1805
87 Ga0207683_10007425 3300026121 Bacteria 9401
88 Ga0268265_10002265 3300028380 Bacteria 14691
89 Ga0268264_10000014 3300028381 Bacteria 509962
90 Ga0265334_10001120 3300028573 Bacteria 13092
91 Ga0265338_10020399 3300028800 Bacteria 6972
92 Ga0265338_10032674 3300028800 Bacteria 5067
93 Ga0265332_10004408 3300031238 Bacteria 6613
94 Ga0265316_10027636 3300031344 Bacteria 4693
95 Ga0265342_10017200 3300031712 Bacteria 4709
96 Ga0265342_10041096 3300031712 Bacteria 2802
97 Ga0307415_100120594 3300032126 Bacteria 1966
98 Ga0373943_0022128 3300035170 Bacteria 2942
99 Ga0373955_0057504 3300035172 Bacteria 2137
100 Ga0373935_0084348 3300035692 Bacteria 2069
101 Ga0373927_0093649 3300035695 Bacteria 1952
102 Ga0373937_0004571 3300036401 Bacteria 11741
103 Ga0373937_0022511 3300036401 Bacteria 5667
104 Ga0373925_0024569 3300037068 Bacteria 4399
105 Ga0395899_0000018 3300037312 Bacteria 423194
106 Ga0436364_0560002 3300037853 Bacteria 93566
107 Ga0436364_0590691 3300037853 Bacteria 7763
108 Ga0436364_0892425 3300037853 Bacteria 2567
109 Ga0395901_0061822 3300038443 Bacteria 3897
110 Ga0436365_1126886 3300039437 Bacteria 1752
111 Ga0436361_0049627 3300039447 Bacteria 2178
112 Ga0436361_0723056 3300039447 Bacteria 7631
113 Ga0436361_1110848 3300039447 Bacteria 8250
114 Ga0436363_1295373 3300039450 Bacteria 3056
115 Ga0436362_0946946 3300039453 Bacteria 3095
116 Ga0451576_0007428 3300045051 Bacteria 13106
117 Ga0451576_0137140 3300045051 Bacteria 2552
118 Ga0466967_0048127 3300045976 Bacteria 3722
119 Ga0495600_0009129 3300046809 Bacteria 6116
120 Ga0496111_0086995 3300048914 Bacteria 2287
121 Ga0496112_0090133 3300048915 Bacteria 3035
122 Ga0501031_0118015 3300049568 Bacteria 1733
123 Ga0501032_0009884 3300049569 Bacteria 6894
124 Ga0501033_0000120 3300049570 Bacteria 75504
125 Ga0501033_0112711 3300049570 Bacteria 1978
126 Ga0501033_0150346 3300049570 Bacteria 1680
127 Ga0501034_0109880 3300049571 Bacteria 2748
128 Ga0501034_0135811 3300049571 Bacteria 2440
129 Ga0501036_0016221 3300049572 Bacteria 6221
130 Ga0501036_0163732 3300049572 Bacteria 1875
131 Ga0501039_0002701 3300049575 Bacteria 13242
132 Ga0501042_0064899 3300049578 Bacteria 2609
133 Ga0501046_0007227 3300049580 Bacteria 9762
134 Ga0501047_0048786 3300049581 Bacteria 4088
135 Ga0501047_0055311 3300049581 Bacteria 3838
136 Ga0501047_0146661 3300049581 Bacteria 2236
137 Ga0501048_0023850 3300049582 Bacteria 4468
138 Ga0501067_0011399 3300049583 Bacteria 4921
139 Ga0501068_0046213 3300049584 Bacteria 2625
140 Ga0501069_0050513 3300049585 Bacteria 2312
141 Ga0501070_0009406 3300049586 Bacteria 8261
142 Ga0501070_0163548 3300049586 Bacteria 1834
143 Ga0501073_0135158 3300049589 Bacteria 1709
144 Ga0501074_0021802 3300049590 Bacteria 4650
145 Ga0501079_0047098 3300049741 Bacteria 3326
146 Ga0501080_0029439 3300049742 Bacteria 5112
147 Ga0501035_0000954 3300049822 Bacteria 30597
148 Ga0501035_0267360 3300049822 Bacteria 1448
149 Ga0501044_0035918 3300049823 Bacteria 5186
150 Ga0501044_0141171 3300049823 Bacteria 2397
151 Ga0501045_0036948 3300049824 Bacteria 3549
152 nmdc:mga08y16_25558_c1 3300050511 Bacteria 6229
153 nmdc:mga08x19_54881_c1 3300050514 Bacteria 2566
154 Ga0495601_0028104 3300053077 Bacteria 3481
155 Ga0501084_0000140 3300054114 Bacteria 54374
156 Ga0501084_0001323 3300054114 Bacteria 19524
157 Ga0501084_0104575 3300054114 Bacteria 2378
158 Ga0501082_0057144 3300060353 Bacteria 3362
159 2512034821 2511231221 Bacteria 6846400
160 2523103442 2522572158 Bacteria 6514390
161 2848861207 2848858292 Bacteria 7391279
162 8054003739 8054002106 Bacteria 7987183
163 Ga0111539_10166131
164 Ga0070658_10102715
165 Ga0070676_10005828
166 Ga0070668_100005886
167 Ga0070659_100051224
168 Ga0070667_100245792
169 Ga0070714_100158215
170 Ga0070713_100004150
171 Ga0070713_100027648
172 Ga0070713_100063525
173 Ga0070713_100148793
174 Ga0070713_100169085
175 Ga0070710_10002330
176 Ga0070711_100011301
177 Ga0070711_100011753
178 Ga0070678_100056968
179 Ga0070681_10000614
180 Ga0070681_10043588
181 Ga0070706_100037492
182 Ga0070698_100006435
183 Ga0070698_100182799
184 Ga0070679_100000410
185 Ga0070684_100042146
186 Ga0070665_100024861
187 Ga0070704_100010003
188 Ga0068856_100015466
189 Ga0068860_100001901
190 Ga0070717_10007628
191 Ga0070712_100004127
192 Ga0068871_100206475
193 Ga0075428_100224545
194 Ga0075436_100014009
195 Ga0075435_100030327
196 Ga0099795_10000291
197 Ga0099795_10001848
198 Ga0099795_10007906
199 Ga0105240_10064934
200 Ga0105240_10079056
201 Ga0105245_10167704
202 Ga0105243_10018988
203 Ga0105242_10007600
204 Ga0099796_10000321
205 Ga0157370_10000971
206 Ga0157370_10004453
207 Ga0157372_10001838
208 Ga0157372_10024997
209 Ga0157372_10190503
210 Ga0157377_10044253
211 Ga0157379_10001360
212 Ga0213874_10000767
213 Ga0213875_10000081
214 Ga0213875_10008671
215 Ga0213875_10035689
216 Ga0209563_101834
217 Ga0209676_1000197
218 Ga0209050_1018758
219 Ga0207645_10011026
220 Ga0207705_10084586
221 Ga0207684_10075857
222 Ga0207684_10087450
223 Ga0207707_10001175
224 Ga0207707_10092699
225 Ga0207693_10001699
226 Ga0207693_10061204
227 Ga0207693_10067523
228 Ga0207663_10008022
229 Ga0207663_10045728
230 Ga0207663_10129099
231 Ga0207652_10002885
232 Ga0207646_10008878
233 Ga0207694_10035169
234 Ga0207659_10024725
235 Ga0207700_10077507
236 Ga0207700_10207452
237 Ga0207664_10022549
238 Ga0207664_10056646
239 Ga0207664_10124397
240 Ga0207690_10030336
241 Ga0207709_10010059
242 Ga0207669_10079482
243 Ga0207689_10059782
244 Ga0207668_10120003
245 Ga0207702_10030791
246 Ga0207702_10060539
247 Ga0207648_10059609
248 Ga0207674_10229199
249 Ga0207683_10007425
250 Ga0268265_10002265
251 Ga0268264_10000014
252 Ga0265334_10001120
253 Ga0265338_10020399
254 Ga0265338_10032674
255 Ga0265332_10004408
256 Ga0265316_10027636
257 Ga0265342_10017200
258 Ga0265342_10041096
259 Ga0307415_100120594
260 Ga0373943_0022128
261 Ga0373955_0057504
262 Ga0373935_0084348
263 Ga0373927_0093649
264 Ga0373937_0004571
265 Ga0373937_0022511
266 Ga0373925_0024569
267 Ga0395899_0000018
268 Ga0436364_0560002
269 Ga0436364_0590691
270 Ga0436364_0892425
271 Ga0395901_0061822
272 Ga0436365_1126886
273 Ga0436361_0049627
274 Ga0436361_0723056
275 Ga0436361_1110848
276 Ga0436363_1295373
277 Ga0436362_0946946
278 Ga0451576_0007428
279 Ga0451576_0137140
280 Ga0466967_0048127
281 Ga0495600_0009129
282 Ga0496111_0086995
283 Ga0496112_0090133
284 Ga0501031_0118015
285 Ga0501032_0009884
286 Ga0501033_0000120
287 Ga0501033_0112711
288 Ga0501033_0150346
289 Ga0501034_0109880
290 Ga0501034_0135811
291 Ga0501036_0016221
292 Ga0501036_0163732
293 Ga0501039_0002701
294 Ga0501042_0064899
295 Ga0501046_0007227
296 Ga0501047_0048786
297 Ga0501047_0055311
298 Ga0501047_0146661
299 Ga0501048_0023850
300 Ga0501067_0011399
301 Ga0501068_0046213
302 Ga0501069_0050513
303 Ga0501070_0009406
304 Ga0501070_0163548
305 Ga0501073_0135158
306 Ga0501074_0021802
307 Ga0501079_0047098
308 Ga0501080_0029439
309 Ga0501035_0000954
310 Ga0501035_0267360
311 Ga0501044_0035918
312 Ga0501044_0141171
313 Ga0501045_0036948
314 nmdc:mga08y16_25558_c1
315 nmdc:mga08x19_54881_c1
316 Ga0495601_0028104
317 Ga0501084_0000140
318 Ga0501084_0001323
319 Ga0501084_0104575
320 Ga0501082_0057144
321 2512034821
322 2523103442
323 2848861207
324 8054003739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01938

TRAM

TRAM domain

421

482

0.95

PF04055

Radical_SAM

Radical SAM superfamily

194

368

0.95

PF00919

UPF0004

Uncharacterized protein family UPF0004

42

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9216 2 436
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9175 2 436
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9168 147 436
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9137 148 436
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9135 147 436
ID Description Score Start End Superfamily
af_P0AEI1_145_378_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9703 147 374 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9694 260 376 3.30.750.200
af_F1LV76_14_128_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9664 259 368 3.30.750.200
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9652 2 131 3.40.50.12160
af_Q2FXZ6_140_373_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9615 149 376 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A3B9YSS9-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9953 359 436 GO:0016740
AF-A0A4Q3K8N4-F1-model_v4 deleted 0.9902 1 114
AF-A0A6G3WU15-F1-model_v4 Radical SAM protein 0.9841 260 380 GO:0005829
GO:0035597
GO:0051539
AF-A0A3B9TUY4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9824 1 119 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A435LFX3-F1-model_v4 deleted 0.9818 2 91

Map