F239574

General Info

Members Datasets Scaffolds Average Seq Length
162 116 324 163

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10557946|Ga0265338_105579462
Length 156
Sequence MASNRHLGRIVALQTLYEQDFRREVGDTNLVLDEVLERNIARYQETIDDKEFIENLVHGVNTHEQELDDVIRPVAPEWPIDQIARMDRMVLHIGVYELLYDDGKVPPKVVINEAVELAKAFGGDNSSKFVNGVLGTILREKEAKPAKAKKTPKAKN

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
107 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
114 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
115 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
116 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.31
Nodule 0
Rhizoplane 0
Rhizosphere 72.22
Stem 0
Stem Tuber 0
Unclassified 25.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10557946 3300028800 Unclassified 801
2 JGI24741J21665_1000226 3300001915 Bacteria 16876
3 JGI24740J21852_10005605 3300001979 Bacteria 5288
4 rootH2_10000244 3300003320 Bacteria 697651
5 rootH2_10204262 3300003320 Bacteria 3384
6 rootH2_10206709 3300003320 Unclassified 1173
7 rootH1_10226882 3300003323 Unclassified 1140
8 Ga0070676_10239783 3300005328 Bacteria 1205
9 Ga0070683_100000112 3300005329 Bacteria 53123
10 Ga0070683_100428918 3300005329 Bacteria 1261
11 Ga0068869_100169586 3300005334 Bacteria 1704
12 Ga0070680_100092015 3300005336 Unclassified 2511
13 Ga0070682_100015931 3300005337 Bacteria 4365
14 Ga0070661_100579619 3300005344 Unclassified 905
15 Ga0070668_101565544 3300005347 Unclassified 603
16 Ga0070675_100721618 3300005354 Unclassified 908
17 Ga0070671_100228642 3300005355 Bacteria 1578
18 Ga0070674_100005409 3300005356 Bacteria 7373
19 Ga0070667_100281074 3300005367 Bacteria 1494
20 Ga0070663_100288783 3300005455 Bacteria 1309
21 Ga0070678_100003010 3300005456 Bacteria 9340
22 Ga0070685_10003963 3300005466 Bacteria 7482
23 Ga0070684_100000049 3300005535 Bacteria 79768
24 Ga0070686_100031217 3300005544 Unclassified 3255
25 Ga0070686_100440167 3300005544 Bacteria 1000
26 Ga0070696_100327794 3300005546 Unclassified 1180
27 Ga0068855_100082181 3300005563 Bacteria 3734
28 Ga0068860_100013616 3300005843 Bacteria 7972
29 Ga0068862_100134154 3300005844 Bacteria 2193
30 Ga0075368_10000065 3300006042 Bacteria 25604
31 Ga0075363_100000022 3300006048 Bacteria 32445
32 Ga0075363_100112350 3300006048 Bacteria 1515
33 Ga0075364_10064884 3300006051 Unclassified 2397
34 Ga0075362_10000063 3300006177 Bacteria 31783
35 Ga0075367_10025939 3300006178 Unclassified 3318
36 Ga0075369_10000010 3300006186 Bacteria 77564
37 Ga0075369_10077515 3300006186 Unclassified 1470
38 Ga0075366_10000001 3300006195 Bacteria 569172
39 Ga0075366_10000138 3300006195 Bacteria 30666
40 Ga0075366_10001938 3300006195 Bacteria 10463
41 Ga0075366_10019344 3300006195 Bacteria 3939
42 Ga0075370_10000462 3300006353 Bacteria 15151
43 Ga0075370_10107490 3300006353 Bacteria 1618
44 Ga0105240_10163575 3300009093 Bacteria 2641
45 Ga0105240_10380677 3300009093 Bacteria 1594
46 Ga0111539_11144516 3300009094 Unclassified 904
47 Ga0105245_10006834 3300009098 Bacteria 10007
48 Ga0105245_11683162 3300009098 Unclassified 687
49 Ga0105243_10032209 3300009148 Unclassified 4048
50 Ga0105241_10000003 3300009174 Bacteria 839043
51 Ga0105241_10294329 3300009174 Bacteria 1391
52 Ga0105241_10589739 3300009174 Bacteria 1003
53 Ga0105248_11158826 3300009177 Bacteria 874
54 Ga0105238_10387220 3300009551 Bacteria 1390
55 Ga0105238_11176176 3300009551 Unclassified 791
56 Ga0105249_10036763 3300009553 Unclassified 4443
57 Ga0105249_10484046 3300009553 Bacteria 1281
58 Ga0157371_10003755 3300013102 Bacteria 13592
59 Ga0157370_10224206 3300013104 Bacteria 1740
60 Ga0157369_10138037 3300013105 Bacteria 2580
61 Ga0157369_10262848 3300013105 Bacteria 1800
62 Ga0157374_10412346 3300013296 Bacteria 1349
63 Ga0163162_10829683 3300013306 Bacteria 1041
64 Ga0157372_10530249 3300013307 Bacteria 1373
65 Ga0157377_10001177 3300014745 Bacteria 11110
66 Ga0157379_11981533 3300014968 Unclassified 575
67 Ga0207645_10236498 3300025907 Bacteria 1206
68 Ga0207654_10000002 3300025911 Bacteria 1460142
69 Ga0207654_10070977 3300025911 Bacteria 2069
70 Ga0207654_10352654 3300025911 Bacteria 1013
71 Ga0207695_10771788 3300025913 Unclassified 841
72 Ga0207657_10003611 3300025919 Bacteria 16490
73 Ga0207652_10533987 3300025921 Unclassified 1055
74 Ga0207652_11057375 3300025921 Unclassified 711
75 Ga0207694_10394356 3300025924 Unclassified 1150
76 Ga0207687_10095025 3300025927 Bacteria 2182
77 Ga0207687_10947354 3300025927 Unclassified 737
78 Ga0207644_11321391 3300025931 Bacteria 606
79 Ga0207690_10000527 3300025932 Bacteria 24894
80 Ga0207709_10049943 3300025935 Unclassified 2555
81 Ga0207669_10006666 3300025937 Bacteria 5292
82 Ga0207689_10209541 3300025942 Bacteria 1610
83 Ga0207661_10000077 3300025944 Bacteria 67190
84 Ga0207661_10709514 3300025944 Bacteria 925
85 Ga0207667_10000003 3300025949 Bacteria 822935
86 Ga0207667_10000060 3300025949 Bacteria 192320
87 Ga0207667_10070739 3300025949 Bacteria 3631
88 Ga0207667_10280915 3300025949 Bacteria 1701
89 Ga0207712_10003874 3300025961 Bacteria 9451
90 Ga0207712_10572852 3300025961 Unclassified 973
91 Ga0207668_11400137 3300025972 Unclassified 630
92 Ga0207674_10000001 3300026116 Bacteria 616581
93 Ga0207674_10067071 3300026116 Bacteria 3613
94 Ga0207675_100854889 3300026118 Unclassified 925
95 Ga0209813_10000001 3300027866 Bacteria 280406
96 Ga0268266_10021620 3300028379 Bacteria 5480
97 Ga0268265_10293601 3300028380 Unclassified 1460
98 Ga0268264_10455585 3300028381 Bacteria 1240
99 Ga0265337_1004925 3300028556 Bacteria 5434
100 Ga0265337_1007142 3300028556 Bacteria 4214
101 Ga0265326_10001740 3300028558 Bacteria 7533
102 Ga0265334_10000115 3300028573 Bacteria 52649
103 Ga0265334_10002006 3300028573 Bacteria 9646
104 Ga0265322_10015050 3300028654 Bacteria 2237
105 Ga0265322_10017267 3300028654 Bacteria 2079
106 Ga0265322_10060624 3300028654 Bacteria 1073
107 Ga0265336_10000424 3300028666 Bacteria 26224
108 Ga0265338_10000003 3300028800 Bacteria 733923
109 Ga0265338_10000039 3300028800 Bacteria 236135
110 Ga0265338_10007299 3300028800 Bacteria 13788
111 Ga0265338_10053135 3300028800 Unclassified 3628
112 Ga0265338_10377828 3300028800 Unclassified 1014
113 Ga0265338_10452441 3300028800 Unclassified 909
114 Ga0265325_10025424 3300031241 Bacteria 3216
115 Ga0265339_10156924 3300031249 Bacteria 1147
116 Ga0265327_10012174 3300031251 Bacteria 5835
117 Ga0265316_10003176 3300031344 Bacteria 16712
118 Ga0265316_10199851 3300031344 Unclassified 1482
119 Ga0265313_10163179 3300031595 Unclassified 945
120 Ga0265314_10158290 3300031711 Bacteria 1381
121 Ga0265314_10423270 3300031711 Unclassified 715
122 Ga0265342_10232901 3300031712 Unclassified 989
123 Ga0395900_0105902 3300037418 Bacteria 2889
124 Ga0395898_0713943 3300037466 Unclassified 944
125 Ga0495582_0056117 3300046473 Bacteria 2171
126 Ga0495609_0030834 3300046538 Bacteria 2441
127 Ga0495622_0000502 3300046557 Bacteria 24435
128 Ga0495635_0336805 3300046663 Bacteria 1008
129 Ga0495658_0000641 3300046683 Bacteria 18915
130 Ga0495671_0194206 3300046692 Bacteria 985
131 Ga0495600_0008925 3300046809 Bacteria 6175
132 Ga0495677_0191919 3300047445 Bacteria 793
133 Ga0495602_0449951 3300048088 Bacteria 909
134 Ga0501073_0076734 3300049589 Unclassified 2325
135 Ga0501080_0000520 3300049742 Bacteria 30275
136 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
137 nmdc:mga03n38_126456_c1 3300050490 Unclassified 1262
138 nmdc:mga03n38_142_c1 3300050490 Bacteria 15721
139 nmdc:mga00v17_56476_c1 3300050491 Unclassified 2400
140 nmdc:mga0yw44_21337_c1 3300050492 Bacteria 3611
141 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
142 nmdc:mga0k408_13_c1 3300050493 Bacteria 48149
143 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
144 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
145 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
146 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
147 nmdc:mga07m45_200704_c1 3300050496 Bacteria 1160
148 nmdc:mga07m45_5621_c1 3300050496 Bacteria 6264
149 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
150 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
151 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
152 nmdc:mga0sz30_71794_c1 3300050516 Unclassified 1491
153 Ga0500643_000022 3300053087 Bacteria 277519
154 Ga0500644_0001037 3300053088 Bacteria 8346
155 Ga0500566_0000001 3300053094 Bacteria 1101031
156 Ga0500614_025688 3300053123 Unclassified 1402
157 Ga0500628_000028 3300053129 Bacteria 59993
158 Ga0500559_0006860 3300053136 Bacteria 5104
159 Ga0500561_0000001 3300053137 Bacteria 957685
160 Ga0500577_0000528 3300053142 Bacteria 9883
161 Ga0500570_000006 3300053724 Bacteria 129824
162 Ga0500611_004452 3300053727 Bacteria 1891
163 Ga0265338_10557946
164 JGI24741J21665_1000226
165 JGI24740J21852_10005605
166 rootH2_10000244
167 rootH2_10204262
168 rootH2_10206709
169 rootH1_10226882
170 Ga0070676_10239783
171 Ga0070683_100000112
172 Ga0070683_100428918
173 Ga0068869_100169586
174 Ga0070680_100092015
175 Ga0070682_100015931
176 Ga0070661_100579619
177 Ga0070668_101565544
178 Ga0070675_100721618
179 Ga0070671_100228642
180 Ga0070674_100005409
181 Ga0070667_100281074
182 Ga0070663_100288783
183 Ga0070678_100003010
184 Ga0070685_10003963
185 Ga0070684_100000049
186 Ga0070686_100031217
187 Ga0070686_100440167
188 Ga0070696_100327794
189 Ga0068855_100082181
190 Ga0068860_100013616
191 Ga0068862_100134154
192 Ga0075368_10000065
193 Ga0075363_100000022
194 Ga0075363_100112350
195 Ga0075364_10064884
196 Ga0075362_10000063
197 Ga0075367_10025939
198 Ga0075369_10000010
199 Ga0075369_10077515
200 Ga0075366_10000001
201 Ga0075366_10000138
202 Ga0075366_10001938
203 Ga0075366_10019344
204 Ga0075370_10000462
205 Ga0075370_10107490
206 Ga0105240_10163575
207 Ga0105240_10380677
208 Ga0111539_11144516
209 Ga0105245_10006834
210 Ga0105245_11683162
211 Ga0105243_10032209
212 Ga0105241_10000003
213 Ga0105241_10294329
214 Ga0105241_10589739
215 Ga0105248_11158826
216 Ga0105238_10387220
217 Ga0105238_11176176
218 Ga0105249_10036763
219 Ga0105249_10484046
220 Ga0157371_10003755
221 Ga0157370_10224206
222 Ga0157369_10138037
223 Ga0157369_10262848
224 Ga0157374_10412346
225 Ga0163162_10829683
226 Ga0157372_10530249
227 Ga0157377_10001177
228 Ga0157379_11981533
229 Ga0207645_10236498
230 Ga0207654_10000002
231 Ga0207654_10070977
232 Ga0207654_10352654
233 Ga0207695_10771788
234 Ga0207657_10003611
235 Ga0207652_10533987
236 Ga0207652_11057375
237 Ga0207694_10394356
238 Ga0207687_10095025
239 Ga0207687_10947354
240 Ga0207644_11321391
241 Ga0207690_10000527
242 Ga0207709_10049943
243 Ga0207669_10006666
244 Ga0207689_10209541
245 Ga0207661_10000077
246 Ga0207661_10709514
247 Ga0207667_10000003
248 Ga0207667_10000060
249 Ga0207667_10070739
250 Ga0207667_10280915
251 Ga0207712_10003874
252 Ga0207712_10572852
253 Ga0207668_11400137
254 Ga0207674_10000001
255 Ga0207674_10067071
256 Ga0207675_100854889
257 Ga0209813_10000001
258 Ga0268266_10021620
259 Ga0268265_10293601
260 Ga0268264_10455585
261 Ga0265337_1004925
262 Ga0265337_1007142
263 Ga0265326_10001740
264 Ga0265334_10000115
265 Ga0265334_10002006
266 Ga0265322_10015050
267 Ga0265322_10017267
268 Ga0265322_10060624
269 Ga0265336_10000424
270 Ga0265338_10000003
271 Ga0265338_10000039
272 Ga0265338_10007299
273 Ga0265338_10053135
274 Ga0265338_10377828
275 Ga0265338_10452441
276 Ga0265325_10025424
277 Ga0265339_10156924
278 Ga0265327_10012174
279 Ga0265316_10003176
280 Ga0265316_10199851
281 Ga0265313_10163179
282 Ga0265314_10158290
283 Ga0265314_10423270
284 Ga0265342_10232901
285 Ga0395900_0105902
286 Ga0395898_0713943
287 Ga0495582_0056117
288 Ga0495609_0030834
289 Ga0495622_0000502
290 Ga0495635_0336805
291 Ga0495658_0000641
292 Ga0495671_0194206
293 Ga0495600_0008925
294 Ga0495677_0191919
295 Ga0495602_0449951
296 Ga0501073_0076734
297 Ga0501080_0000520
298 nmdc:mga03683_80_c1
299 nmdc:mga03n38_126456_c1
300 nmdc:mga03n38_142_c1
301 nmdc:mga00v17_56476_c1
302 nmdc:mga0yw44_21337_c1
303 nmdc:mga0yw44_2_c1
304 nmdc:mga0k408_13_c1
305 nmdc:mga0k408_214_c1
306 nmdc:mga0k408_2889_c1
307 nmdc:mga06z11_15_c1
308 nmdc:mga04h51_1_c1
309 nmdc:mga07m45_200704_c1
310 nmdc:mga07m45_5621_c1
311 nmdc:mga08y16_5295_c1
312 nmdc:mga0sz30_1_c1
313 nmdc:mga0sz30_3_c9
314 nmdc:mga0sz30_71794_c1
315 Ga0500643_000022
316 Ga0500644_0001037
317 Ga0500566_0000001
318 Ga0500614_025688
319 Ga0500628_000028
320 Ga0500559_0006860
321 Ga0500561_0000001
322 Ga0500577_0000528
323 Ga0500570_000006
324 Ga0500611_004452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

6

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9244 6 144
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.924 5 139
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.9185 4 140
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9125 5 139
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.9087 1 139
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9448 6 139 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9357 5 136 1.10.940.10
1tztA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9221 5 139 1.10.940.10
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9192 4 139 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9185 4 140 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A521GMP9-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9937 1 139 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7QSI4-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9937 1 142 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7RAK2-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9899 1 142 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A258GB26-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9882 1 137 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A1F7R6K1-F1-model_v4 N utilization substance protein B 0.9861 1 111 GO:0003723
GO:0031564

Map