F239578

General Info

Members Datasets Scaffolds Average Seq Length
162 124 134 216

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10104021|Ga0307511_101040212
Length 249
Sequence MNNSVTNTARLLWAGLRALLVLTLVTGVIYPLAITGVAQGLFNNKANGSEIKSEGKVVGSSLIGQQGYSLDYFQPRPANGLGTNSVNTQYKLILSGATNRSGDNAQLIKWVTDAKAKVVKDNSVPGYTVEPSDVPADAVTSSGSGLDPDISPQYADIQVHRVAEKNGLTVAQVQKLVDEHTEGRTLGFIGEPTVNVLELNIALKELVAKADGLTCATRESAVGEPAHCVDSRTTYGISHQAYDVKGTHR

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
4 2643221714 Streptomyces sp. Root264 Isolate Unclassified
5 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
6 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
7 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
8 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
9 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
10 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
11 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
12 2862574272 Streptomyces sp. AcE210 Isolate Nodule
13 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
14 2867428634 Streptomyces sp. RP5T Isolate Unclassified
15 2867475112 Streptomyces sp. TM32 Isolate Unclassified
16 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
17 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
18 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
19 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
20 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
21 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
58 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
59 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
120 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
121 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
122 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
123 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
124 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.72
Metatranscriptomes 0
Isolates 17.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 1.23
Rhizoplane 1.23
Rhizosphere 62.35
Stem 0
Stem Tuber 0
Unclassified 30.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023133 3300001989 Bacteria 2198
2 JGI24737J22298_10039772 3300001990 Bacteria 1445
3 JGI24735J21928_10100650 3300002067 Bacteria 830
4 JGI24738J21930_10016761 3300002075 Bacteria 1544
5 rootH1_10097608 3300003316 Bacteria 1011
6 rootH2_10003493 3300003320 Bacteria 1495
7 rootL2_10089979 3300003322 Bacteria 1132
8 rootL2_10145359 3300003322 Bacteria 1340
9 rootH1_10019148 3300003323 Bacteria 13568
10 rootH1_10040835 3300003323 Bacteria 2338
11 Ga0070698_100570278 3300005471 Bacteria 1072
12 Ga0068854_100069981 3300005578 Bacteria 2564
13 Ga0075363_100004605 3300006048 Bacteria 6054
14 Ga0070715_10095332 3300006163 Bacteria 1378
15 Ga0075370_10034767 3300006353 Bacteria 2826
16 Ga0157369_10378291 3300013105 Bacteria 1470
17 Ga0157372_11762713 3300013307 Bacteria 712
18 Ga0182006_1032625 3300015261 Bacteria 2091
19 Ga0182007_10001270 3300015262 Bacteria 13699
20 Ga0183367_1003 3300015688 Bacteria 814276
21 Ga0207426_1002813 3300025302 Bacteria 10408
22 Ga0207426_1024021 3300025302 Bacteria 2073
23 Ga0207713_1025518 3300025735 Bacteria 2726
24 Ga0207647_10237838 3300025904 Bacteria 1046
25 Ga0307511_10000457 3300030521 Bacteria 44027
26 Ga0307511_10104021 3300030521 Bacteria 1846
27 Ga0307512_10000296 3300030522 Bacteria 71852
28 Ga0307513_10132116 3300031456 Bacteria 2440
29 Ga0307513_10171933 3300031456 Bacteria 2043
30 Ga0307513_10268403 3300031456 Bacteria 1491
31 Ga0307509_10010467 3300031507 Bacteria 11359
32 Ga0307509_10045811 3300031507 Bacteria 4712
33 Ga0307509_10084853 3300031507 Bacteria 3261
34 Ga0307509_10190722 3300031507 Bacteria 1901
35 Ga0307508_10027230 3300031616 Bacteria 5177
36 Ga0307508_10087782 3300031616 Bacteria 2694
37 Ga0307508_10382678 3300031616 Bacteria 998
38 Ga0307514_10095314 3300031649 Bacteria 2153
39 Ga0307516_10022037 3300031730 Bacteria 6547
40 Ga0307516_10034625 3300031730 Bacteria 5073
41 Ga0307516_10389459 3300031730 Bacteria 1054
42 Ga0307518_10067986 3300031838 Bacteria 2583
43 Ga0307518_10135556 3300031838 Bacteria 1724
44 Ga0307518_10191776 3300031838 Bacteria 1368
45 Ga0307518_10257413 3300031838 Bacteria 1103
46 Ga0307416_101317014 3300032002 Bacteria 828
47 Ga0307507_10247923 3300033179 Bacteria 1155
48 Ga0307510_10045903 3300033180 Bacteria 4706
49 Ga0307510_10269716 3300033180 Bacteria 1178
50 Ga0307510_10309469 3300033180 Bacteria 1039
51 Ga0307510_10330814 3300033180 Bacteria 978
52 Ga0395900_0535001 3300037418 Bacteria 1118
53 Ga0395898_0181366 3300037466 Bacteria 2012
54 Ga0439436_0006818 3300041404 Bacteria 3508
55 Ga0451837_1410504 3300041494 Bacteria 2379
56 Ga0451841_0518128 3300041498 Bacteria 1053
57 Ga0451843_1529025 3300041509 Bacteria 903
58 Ga0451853_0132877 3300041512 Bacteria 971
59 Ga0451853_0225658 3300041512 Bacteria 1581
60 Ga0451853_1893897 3300041512 Bacteria 2803
61 Ga0451853_3945546 3300041512 Bacteria 1218
62 Ga0439433_0009168 3300041999 Bacteria 2154
63 Ga0439448_0028367 3300042005 Bacteria 1767
64 Ga0439449_0000550 3300042007 Bacteria 14055
65 Ga0439449_0101776 3300042007 Bacteria 1062
66 Ga0439455_0024974 3300042012 Bacteria 1449
67 Ga0439462_0053119 3300042015 Bacteria 1091
68 Ga0450903_001385 3300042138 Bacteria 4526
69 Ga0439458_0000333 3300042157 Bacteria 11798
70 Ga0466972_0008077 3300044658 Bacteria 5274
71 Ga0466972_0033739 3300044658 Bacteria 2510
72 Ga0466965_0008303 3300044683 Bacteria 4800
73 Ga0466965_0015669 3300044683 Bacteria 3602
74 Ga0466965_0071553 3300044683 Bacteria 1745
75 Ga0466966_0017886 3300044684 Bacteria 4681
76 Ga0466961_0001152 3300044693 Bacteria 16234
77 Ga0466961_0042778 3300044693 Bacteria 2903
78 Ga0466961_0082823 3300044693 Bacteria 2029
79 Ga0466968_0117630 3300044735 Bacteria 1200
80 Ga0466970_0056492 3300044765 Bacteria 2097
81 Ga0466970_0132215 3300044765 Bacteria 1371
82 Ga0466957_0001011 3300044842 Bacteria 14480
83 Ga0466960_0281901 3300044901 Bacteria 932
84 Ga0466959_0000964 3300045049 Bacteria 17107
85 Ga0466958_0000556 3300045836 Bacteria 15873
86 Ga0466967_0001512 3300045976 Bacteria 13583
87 Ga0495617_020215 3300046452 Bacteria 2250
88 Ga0495617_132917 3300046452 Bacteria 797
89 Ga0495603_0000396 3300046455 Bacteria 23900
90 Ga0495603_0110393 3300046455 Bacteria 1604
91 Ga0495603_0247897 3300046455 Bacteria 1025
92 Ga0495629_0006270 3300046459 Bacteria 8827
93 Ga0495651_0002822 3300046462 Bacteria 13460
94 Ga0495662_0151514 3300046476 Bacteria 1142
95 Ga0495585_0071310 3300046492 Bacteria 1894
96 Ga0495594_0022564 3300046499 Bacteria 3367
97 Ga0495609_0113429 3300046538 Bacteria 1169
98 Ga0495622_0020811 3300046557 Bacteria 3053
99 Ga0495634_0026226 3300046642 Bacteria 4068
100 Ga0495611_0098387 3300046648 Bacteria 1357
101 Ga0495635_0304877 3300046663 Bacteria 1067
102 Ga0495657_0123100 3300046675 Bacteria 1632
103 Ga0495646_0188739 3300046680 Bacteria 1127
104 Ga0495613_0047603 3300046689 Bacteria 3167
105 Ga0495589_0053964 3300046794 Bacteria 1982
106 Ga0495604_0000340 3300047317 Bacteria 41703
107 Ga0495636_0146972 3300047318 Bacteria 1056
108 Ga0495636_0156448 3300047318 Bacteria 1025
109 Ga0495636_0247911 3300047318 Bacteria 823
110 Ga0495676_0360514 3300047321 Bacteria 970
111 Ga0495683_0009147 3300047323 Bacteria 5278
112 Ga0495687_030315 3300047443 Bacteria 2491
113 Ga0495687_092429 3300047443 Bacteria 1155
114 Ga0495675_0019878 3300047444 Bacteria 4268
115 Ga0495685_002519 3300047447 Bacteria 5751
116 Ga0495686_0011527 3300047472 Bacteria 6227
117 Ga0495614_0137693 3300048089 Bacteria 1083
118 Ga0495614_0138085 3300048089 Bacteria 1082
119 Ga0496109_0037172 3300048912 Bacteria 4399
120 Ga0496113_0482553 3300048916 Bacteria 996
121 Ga0501032_0251621 3300049569 Bacteria 1147
122 Ga0501033_0083431 3300049570 Bacteria 2342
123 Ga0501036_0017922 3300049572 Bacteria 5928
124 Ga0501038_0000216 3300049574 Bacteria 49515
125 Ga0501043_0510402 3300049579 Bacteria 897
126 Ga0501047_0020097 3300049581 Bacteria 6413
127 Ga0501070_0492008 3300049586 Bacteria 986
128 Ga0501035_0060086 3300049822 Bacteria 3384
129 Ga0501044_0006872 3300049823 Bacteria 12533
130 nmdc:mga03n38_7714_c1 3300050490 Bacteria 3820
131 nmdc:mga07m45_62073_c1 3300050496 Bacteria 2117
132 Ga0500573_0085354 3300053140 Bacteria 1790
133 Ga0466962_0000796 3300061719 Bacteria 14215
134 Ga0466962_0049628 3300061719 Bacteria 2006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0510402 Ga0501043_0510402_21_581 186
2 iso_pu_bacteria 2808606375 2808914826 199
3 iso_pu_bacteria 8033684223 8033687676 199
4 iso_pu_bacteria 8048406513 8048410628 199
5 iso_pu_bacteria 2862281513 2862282065 200
6 3300003322 rootL2_10089979 rootL2_100899792 203
7 3300041512 Ga0451853_0225658 Ga0451853_0225658_384_1004 203
8 3300049574 Ga0501038_0000216 Ga0501038_0000216_45959_46570 203
9 3300049570 Ga0501033_0083431 Ga0501033_0083431_633_1250 204
10 3300049572 Ga0501036_0017922 Ga0501036_0017922_2140_2757 204
11 3300049822 Ga0501035_0060086 Ga0501035_0060086_471_1088 204
12 iso_pu_bacteria 2582581313 2585302824 206
13 iso_pu_bacteria 2784746763 2785339462 206
14 iso_pu_bacteria 2784746768 2785367009 206
15 iso_pu_bacteria 2786546132 2786671302 206
16 iso_pu_bacteria 2863404153 2863409583 206
17 iso_pu_bacteria 2867428634 2867432759 206
18 iso_pu_bacteria 2912715099 2912722646 206
19 iso_pu_bacteria 2954673503 2954677625 206
20 iso_pu_bacteria 2954682443 2954686529 206
21 3300041494 Ga0451837_1410504 Ga0451837_1410504_447_1088 209
22 3300003316 rootH1_10097608 rootH1_100976082 210
23 3300003320 rootH2_10003493 rootH2_100034932 210
24 3300003323 rootH1_10019148 rootH1_100191482 210
25 3300003323 rootH1_10040835 rootH1_100408352 210
26 3300005471 Ga0070698_100570278 Ga0070698_1005702782 210
27 3300006048 Ga0075363_100004605 Ga0075363_1000046052 210
28 3300006163 Ga0070715_10095332 Ga0070715_100953322 210
29 3300006353 Ga0075370_10034767 Ga0075370_100347673 210
30 3300013307 Ga0157372_11762713 Ga0157372_117627131 210
31 3300015261 Ga0182006_1032625 Ga0182006_10326252 210
32 3300015262 Ga0182007_10001270 Ga0182007_100012702 210
33 3300015688 Ga0183367_1003 Ga0183367_100322 210
34 3300025735 Ga0207713_1025518 Ga0207713_10255182 210
35 3300030521 Ga0307511_10000457 Ga0307511_1000045716 210
36 3300030521 Ga0307511_10104021 Ga0307511_101040212 210
37 3300031456 Ga0307513_10171933 Ga0307513_101719333 210
38 3300031456 Ga0307513_10268403 Ga0307513_102684032 210
39 3300031507 Ga0307509_10045811 Ga0307509_100458114 210
40 3300031507 Ga0307509_10084853 Ga0307509_100848533 210
41 3300031616 Ga0307508_10087782 Ga0307508_100877822 210
42 3300031649 Ga0307514_10095314 Ga0307514_100953142 210
43 3300031730 Ga0307516_10022037 Ga0307516_100220374 210
44 3300031838 Ga0307518_10135556 Ga0307518_101355562 210
45 3300031838 Ga0307518_10191776 Ga0307518_101917761 210
46 3300033180 Ga0307510_10045903 Ga0307510_100459032 210
47 3300037418 Ga0395900_0535001 Ga0395900_0535001_229_861 210
48 3300037466 Ga0395898_0181366 Ga0395898_0181366_467_1099 210
49 3300041404 Ga0439436_0006818 Ga0439436_0006818_2099_2731 210
50 3300041498 Ga0451841_0518128 Ga0451841_0518128_201_833 210
51 3300041512 Ga0451853_3945546 Ga0451853_3945546_353_985 210
52 3300041999 Ga0439433_0009168 Ga0439433_0009168_1292_1924 210
53 3300042005 Ga0439448_0028367 Ga0439448_0028367_1012_1644 210
54 3300042007 Ga0439449_0000550 Ga0439449_0000550_3690_4325 210
55 3300042007 Ga0439449_0101776 Ga0439449_0101776_341_973 210
56 3300042012 Ga0439455_0024974 Ga0439455_0024974_364_996 210
57 3300042015 Ga0439462_0053119 Ga0439462_0053119_105_749 210
58 3300042138 Ga0450903_001385 Ga0450903_001385_999_1631 210
59 3300042157 Ga0439458_0000333 Ga0439458_0000333_2709_3341 210
60 3300044658 Ga0466972_0033739 Ga0466972_0033739_10_642 210
61 3300044683 Ga0466965_0008303 Ga0466965_0008303_4001_4633 210
62 3300044683 Ga0466965_0071553 Ga0466965_0071553_277_909 210
63 3300044693 Ga0466961_0001152 Ga0466961_0001152_7865_8497 210
64 3300044693 Ga0466961_0082823 Ga0466961_0082823_82_714 210
65 3300044765 Ga0466970_0056492 Ga0466970_0056492_543_1175 210
66 3300044765 Ga0466970_0132215 Ga0466970_0132215_370_1002 210
67 3300044842 Ga0466957_0001011 Ga0466957_0001011_1901_2533 210
68 3300044901 Ga0466960_0281901 Ga0466960_0281901_198_830 210
69 3300045049 Ga0466959_0000964 Ga0466959_0000964_7344_7976 210
70 3300045836 Ga0466958_0000556 Ga0466958_0000556_6010_6642 210
71 3300045976 Ga0466967_0001512 Ga0466967_0001512_3070_3702 210
72 3300047318 Ga0495636_0146972 Ga0495636_0146972_338_970 210
73 3300047443 Ga0495687_030315 Ga0495687_030315_43_687 210
74 3300047472 Ga0495686_0011527 Ga0495686_0011527_5369_6004 210
75 3300048912 Ga0496109_0037172 Ga0496109_0037172_3167_3835 210
76 3300049569 Ga0501032_0251621 Ga0501032_0251621_312_968 210
77 3300049581 Ga0501047_0020097 Ga0501047_0020097_2196_2852 210
78 3300049586 Ga0501070_0492008 Ga0501070_0492008_299_955 210
79 3300049823 Ga0501044_0006872 Ga0501044_0006872_4262_4918 210
80 3300050490 nmdc:mga03n38_7714_c1 nmdc:mga03n38_7714_c1_1255_1887 210
81 3300050496 nmdc:mga07m45_62073_c1 nmdc:mga07m45_62073_c1_1475_2107 210
82 3300053140 Ga0500573_0085354 Ga0500573_0085354_260_895 210
83 3300061719 Ga0466962_0000796 Ga0466962_0000796_1853_2485 210
84 iso_pu_bacteria 2852635781 2852638609 210
85 iso_pu_bacteria 8025478263 8025484107 211
86 3300048916 Ga0496113_0482553 Ga0496113_0482553_169_810 212
87 iso_pu_bacteria 2867475112 2867481249 212
88 iso_pu_bacteria 8056447290 8056449021 212
89 iso_pu_bacteria 8056667051 8056669890 212
90 3300044658 Ga0466972_0008077 Ga0466972_0008077_4108_4788 213
91 3300044683 Ga0466965_0015669 Ga0466965_0015669_2420_3100 213
92 3300044684 Ga0466966_0017886 Ga0466966_0017886_95_775 213
93 3300044693 Ga0466961_0042778 Ga0466961_0042778_16_696 213
94 3300044735 Ga0466968_0117630 Ga0466968_0117630_389_1069 213
95 3300025302 Ga0207426_1024021 Ga0207426_10240212 215
96 3300031616 Ga0307508_10027230 Ga0307508_100272302 215
97 3300031730 Ga0307516_10034625 Ga0307516_100346253 215
98 iso_pu_bacteria 8054160619 8054167302 215
99 3300025302 Ga0207426_1002813 Ga0207426_10028135 216
100 iso_pu_bacteria 2997451912 2997459582 216
101 iso_pu_bacteria 2966598605 2966604924 217
102 iso_pu_bacteria 2616644941 2616902299 218
103 iso_pu_bacteria 2643221714 2644627465 218
104 iso_pu_bacteria 2818991463 2819699211 218
105 iso_pu_bacteria 2862574272 2862580161 218
106 iso_pu_bacteria 2862574272 2862580800 218
107 iso_pu_bacteria 2877676314 2877676682 218
108 3300032002 Ga0307416_101317014 Ga0307416_1013170141 221
109 iso_pu_bacteria 2582581312 2585297264 221
110 3300001989 JGI24739J22299_10023133 JGI24739J22299_100231332 222
111 3300001990 JGI24737J22298_10039772 JGI24737J22298_100397722 222
112 3300002067 JGI24735J21928_10100650 JGI24735J21928_101006501 222
113 3300002075 JGI24738J21930_10016761 JGI24738J21930_100167611 222
114 3300003322 rootL2_10145359 rootL2_101453591 222
115 3300005578 Ga0068854_100069981 Ga0068854_1000699812 222
116 3300013105 Ga0157369_10378291 Ga0157369_103782912 222
117 3300025904 Ga0207647_10237838 Ga0207647_102378381 222
118 3300030522 Ga0307512_10000296 Ga0307512_1000029675 222
119 3300031456 Ga0307513_10132116 Ga0307513_101321162 222
120 3300031507 Ga0307509_10010467 Ga0307509_100104679 222
121 3300031507 Ga0307509_10190722 Ga0307509_101907222 222
122 3300031616 Ga0307508_10382678 Ga0307508_103826782 222
123 3300031730 Ga0307516_10389459 Ga0307516_103894592 222
124 3300031838 Ga0307518_10067986 Ga0307518_100679863 222
125 3300031838 Ga0307518_10257413 Ga0307518_102574132 222
126 3300033179 Ga0307507_10247923 Ga0307507_102479232 222
127 3300033180 Ga0307510_10269716 Ga0307510_102697162 222
128 3300033180 Ga0307510_10309469 Ga0307510_103094691 222
129 3300033180 Ga0307510_10330814 Ga0307510_103308142 222
130 3300041509 Ga0451843_1529025 Ga0451843_1529025_31_699 222
131 3300041512 Ga0451853_0132877 Ga0451853_0132877_44_712 222
132 3300041512 Ga0451853_1893897 Ga0451853_1893897_1488_2159 222
133 3300046452 Ga0495617_020215 Ga0495617_020215_1183_1851 222
134 3300046452 Ga0495617_132917 Ga0495617_132917_69_776 222
135 3300046455 Ga0495603_0000396 Ga0495603_0000396_22843_23550 222
136 3300046455 Ga0495603_0110393 Ga0495603_0110393_817_1494 222
137 3300046455 Ga0495603_0247897 Ga0495603_0247897_299_967 222
138 3300046459 Ga0495629_0006270 Ga0495629_0006270_32_709 222
139 3300046462 Ga0495651_0002822 Ga0495651_0002822_11377_12045 222
140 3300046476 Ga0495662_0151514 Ga0495662_0151514_430_1098 222
141 3300046492 Ga0495585_0071310 Ga0495585_0071310_358_1065 222
142 3300046499 Ga0495594_0022564 Ga0495594_0022564_1361_2038 222
143 3300046538 Ga0495609_0113429 Ga0495609_0113429_289_957 222
144 3300046557 Ga0495622_0020811 Ga0495622_0020811_1424_2101 222
145 3300046642 Ga0495634_0026226 Ga0495634_0026226_239_907 222
146 3300046648 Ga0495611_0098387 Ga0495611_0098387_589_1296 222
147 3300046663 Ga0495635_0304877 Ga0495635_0304877_90_758 222
148 3300046675 Ga0495657_0123100 Ga0495657_0123100_392_1060 222
149 3300046680 Ga0495646_0188739 Ga0495646_0188739_396_1064 222
150 3300046689 Ga0495613_0047603 Ga0495613_0047603_2451_3119 222
151 3300046794 Ga0495589_0053964 Ga0495589_0053964_283_990 222
152 3300047317 Ga0495604_0000340 Ga0495604_0000340_5880_6548 222
153 3300047318 Ga0495636_0156448 Ga0495636_0156448_55_732 222
154 3300047318 Ga0495636_0247911 Ga0495636_0247911_92_799 222
155 3300047321 Ga0495676_0360514 Ga0495676_0360514_95_763 222
156 3300047323 Ga0495683_0009147 Ga0495683_0009147_3962_4630 222
157 3300047443 Ga0495687_092429 Ga0495687_092429_290_958 222
158 3300047444 Ga0495675_0019878 Ga0495675_0019878_2538_3206 222
159 3300047447 Ga0495685_002519 Ga0495685_002519_4979_5686 222
160 3300048089 Ga0495614_0137693 Ga0495614_0137693_335_1003 222
161 3300048089 Ga0495614_0138085 Ga0495614_0138085_48_755 222
162 3300061719 Ga0466962_0049628 Ga0466962_0049628_156_845 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

12

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7079 14 219
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7013 12 218
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.6943 14 219
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.6813 12 218
2y1h-assembly1.cif.gz_B crystal structure of the human tatd-domain protein 3 (tatdn3) 0.534 165 218
ID Description Score Start End Superfamily
af_Q9VFT7_637_714_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5842 160 211 1.10.238.10
af_A0A1D8PN91_312_399_1.10.238.100 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;YAP1 redox domain. Chain B 0.5341 171 219 1.10.238.100
af_Q91WD9_88_188_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5333 160 216 1.10.238.10
5i44K00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5008 171 221 1.10.1660.10
af_A0A1D6FSW5_203_270_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4783 160 210 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A8B3G858-F1-model_v4 deleted 0.9494 162 216
AF-A0A4Q6CGJ9-F1-model_v4 deleted 0.9447 162 218
AF-A0A1N7DLN9-F1-model_v4 K+-transporting ATPase ATPase C chain 0.9383 146 218 GO:0005524
GO:0005886
GO:0008556
AF-A0A658NX10-F1-model_v4 Potassium-transporting ATPase subunit C 0.9381 146 218 GO:0005524
GO:0005886
GO:0008556
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9321 146 216 GO:0005524
GO:0005886
GO:0008556

Feature Viewer

pLDDT pTM Quality
81.61 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map